KEGG   Paenibacillus sp. Y412MC10: GYMC10_2644Help
Entry
GYMC10_2644       CDS       T01100                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gym00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3009245..3011104
Genome map
AA seq 619 aa AA seqDB search
MGMLTWENGQYLLDGQPYRIISGAIHYFRVVPEYWEDRLLKLKACGFNTVETYIAWNVHE
PQEGEFNFSGMADVASFIELAGKLGLHVIVRPSPFICAEWEFGGLPGWLLGYGEIRLRCS
DPLYLSKVDHYYDELIPQLVPLLSTHGGPILAVQVENEYGSYGNDHAYLEYLREGLVRRG
VDVLLFTSDGPTDEMLLGGTLSDVHATVNFGSRVEESFRKYREYRAEEPLMVMEFWNGWF
DHWMEDHHVRDAADVAGVLDEMLEMGSSMNMYMFHGGTNFGFYSGANHIQAYEPTTTSYD
YDAPLTEWGDKTEKYEAVRRVLSKHGFAPGCAFPEPVPKAAYGKVAMSEMAGLFTETNLQ
QLSEPIKSVCIQPMEKCGQSYGFIMYSTFIQGPRHGQQLHIQEVRDRAQVFLDGRPLGVV
ERWNSKPLDITVPADGARLDILVENMGRINYGPLIRDPKGITEGVRIDNQFLYDWTIRTL
PLEPEKLSSLTYTPVTQEGQARQEEPSMPERGDAGLPGFYRGCFEVEEIGDTFLRFDGWT
KGVAWINGFNLGRYWKAGPQKALYIPGPLLRKGENELVLFELHGRPECCEAELSDQPDLG
QTAAVDEAVLNFVQEGEDK
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgctgacatgggagaacggacaatacttgttggacggacagccgtaccggatc
atatcgggagcgattcactattttcgtgtcgtccctgaatattgggaggacaggctatta
aaattaaaggcctgcggctttaataccgttgaaacttatatcgcatggaatgtgcacgaa
ccccaggagggggaatttaactttagcggtatggcagacgtcgcatcgtttatcgaattg
gccgggaaactgggcctgcacgtcatcgtcagacccagcccgttcatctgtgcggaatgg
gaatttggtgggttgccgggctggctgcttggttatggagaaatacggcttcgctgcagc
gacccgctctatttgagcaaagtggatcattattacgatgagctgatcccccaattggtt
ccgctgctatccacgcacggggggccgattctggctgttcaggttgaaaatgaatacggc
agttacggcaacgatcacgcttatctggagtatttacgcgaaggactggtgcggcgcggc
gtcgacgtgcttctctttacttccgacgggccaaccgacgaaatgctgctcggtgggacg
cttagcgatgtgcacgcaactgtgaattttggttcccgggttgaagaatccttccgcaaa
taccgggaatatcgtgcggaagagccgctgatggtgatggagttttggaacggctggttt
gatcactggatggaggaccatcacgtgcgggatgccgcggatgtcgccggcgtactggat
gaaatgctggagatgggctcctcgatgaatatgtacatgttccacgggggaaccaatttc
ggcttttacagtggagcgaatcacatccaggcctatgagcctacgacgacaagctacgac
tatgatgcccctttgacggaatggggggataaaacggagaaatacgaggcggtccggagg
gtgctcagcaagcatgggtttgcgccggggtgtgccttccctgagcccgttccaaaagca
gcctacggaaaggttgccatgtctgaaatggccggcctgtttacggaaaccaatctccag
caattgtcagagccgataaaaagcgtgtgcattcagccgatggaaaaatgcggacagtcc
tatggttttatcatgtacagcacatttatccagggaccgcggcacggtcagcagctgcat
attcaggaggttcgtgatcgcgcccaggtattcctggacggtcgcccgcttggggtcgtc
gaacgctggaattcaaaaccgctggatattaccgtacccgcagacggagcgaggctggat
attctcgtcgagaatatgggccggatcaattatgggccgctgattcgcgatcccaaggga
atcacggaaggcgtgagaatcgataaccagttcctgtacgactggacgatccggaccctg
ccgctcgagccggagaaactgtcatcgctcacgtatacgccggttacgcaggaagggcag
gcgcggcaagaagaaccgtccatgccggagaggggcgacgcgggtctgccagggttttac
cgtggatgcttcgaggtggaggagatcggagatacgtttcttcgctttgatggttggacg
aagggcgtcgcctggatcaatggctttaatctcggccggtactggaaggcgggaccgcag
aaggcactatatattcccggacctttactgcgcaaaggggaaaacgagttggttcttttt
gaactgcacggccgtcccgaatgctgcgaagcagaactgtcagatcaaccggaccttgga
cagaccgcggcagtggacgaagctgtgcttaatttcgttcaagagggagaagacaagtag

DBGET integrated database retrieval system