KEGG   Paenibacillus sp. Y412MC10: GYMC10_2763Help
Entry
GYMC10_2763       CDS       T01100                                 

Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    GYMC10_2763
  Amino acid metabolism
   00380 Tryptophan metabolism
    GYMC10_2763
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GYMC10_2763
Enzymes [BR:gym01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     GYMC10_2763
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     GYMC10_2763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3150446..3153631
Genome map
AA seq 1061 aa AA seqDB search
MTQTKEVPQPKTYGPLGNLPLLDSAAPVQSLVKVASELGPIFQFQYPGGRKELYVSGHEY
VKDACDEKRFDKRIWAPLQNVRPFAGDGLFTSATQEPNWKKAHNILLSSFSQRAMQGYHT
KMVDIAMQLIQKWARLNPDETVDVPADMTRLTLDTIGLCGFNYRFNSFYREDNHPFIDSM
VRALDEGMNQLHRLGIQDMFMIKKKRQFQEDIQFMFSLVDELIQDRRKHGGEEGDLLAHM
LEGVDPDTGESLDHENIRYQIITFLIAGHETTSGLLSFAIYYLMKNPEALFKAVSEVDRV
LKDPVPTYNQVRELKYVRMVLNESLRLWPTAPAFSLYAKEDTAIGGTYPMKKGDSVTVLI
PALHRDSRVWGDDAETFRPERFEDPSRVPHDAYKPFGNGQRACIGQQFALQEATLVLGLV
LKYFELIDNQPYELQVKETLTLKPEGFRIQVRSRQGGTALLVPGGGQVASLESKKRDDAK
SDPSAAFAHHTPLLALYGSNLGTAEGIAREVADAAKHQGFDSQVGTLDEYAGKLPKEGVV
VIVTASYNGQPPSNAKAFMEWLENANESEIEGVRYAVFGCGDHNWASTYQRIPRLIDEQL
SLKGGQRLIHRGESDASGDFEREVDEWTEHLWPDLMQSLGLPVTAVHGQKRSALSVQFVQ
GTAAVPLTETYRAVTGRIVFSRNLQHEGSGRITQHIEISLPPGTEYREGDHLGVLPVNPK
TLVQRVLRRFKLNAGSHLILSAEGRSGAHLPTGIPVRLDDLLSRSVELQEPATMAQIREM
AASTVCPPHAKELQELIEEASYQAEVRAKRITMLDLLERYEACELPFERFLELLPPLKPR
YYSISSSPKVSRNTASVTVSVVRDRAWSGKGEYRGIASNYLAELETGAEVLMFIRSPESG
FALPEDPATPMIMIGPGTGVAPFRGFIQARQALREAGQELGAAHLYFGCRNPEQDFLYRE
EFERAEQEGLVTLHTAFSRVSGAEKCYVQHLMKQDGMLLLSLLEGGAQMYICGDGSRMAP
EVEQTLIQSYQERHGVNAEDAAAWLSGLESTGQYVKDVWAG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaaccaaggaagtgcctcagcctaaaacctacggtccgctcggcaatctgccg
ctgctggattccgccgcaccggtccaatcgcttgtgaaagttgcctctgagctcggaccg
atctttcaatttcaatatccaggcggacgcaaggaactgtacgtttcgggacatgaatat
gtcaaggatgcttgtgacgagaagcggtttgataaacgaatctgggcaccgctgcagaat
gtccgcccattcgcgggggatggattgtttacgagcgccacgcaggagccaaactggaaa
aaagcccataacattctgctctccagcttcagccagcgcgcgatgcaaggctaccacacc
aaaatggtcgatatcgccatgcagctgatccagaaatgggctcggctcaatccggacgaa
accgtggacgttcctgccgacatgacgcgcttgacgctggatacgatcggcctttgcgga
tttaattaccggtttaacagcttctaccgcgaagacaaccatccatttatcgacagtatg
gtgcgggcgctggatgagggcatgaaccagcttcatcgtctgggcatccaggacatgttt
atgattaaaaagaaacggcagtttcaggaggatatccagttcatgttctccctcgtggat
gagctcatccaagatcgcagaaagcacggcggggaagaaggggatttgctcgcgcatatg
ctggaaggcgtcgatcccgatacaggcgagtctctcgatcatgagaacatccgttaccag
atcatcacctttctgatcgccggacatgagacgacaagcggcttgttgtcctttgccatt
tattatttgatgaaaaatccggaagccttgtttaaggcagtcagcgaagtggaccgcgta
ctgaaagatcccgttccgacctataaccaggtgagggaactcaaatatgtccgcatggta
ctcaacgagtcgctgcgcttatggccaacggcgcctgctttctccttgtatgcgaaggaa
gatacggcgatcgggggaacctatcccatgaagaaaggggacagcgtgaccgtcctgatc
ccagcgctccatcgggactcgcgggtgtggggggacgacgcggaaacgttcagacctgaa
cgcttcgaggatccgagccgggtgccgcatgacgcttacaaaccgtttggtaacggccaa
cgcgcctgcatcgggcagcagtttgcgctgcaggaagcaaccctggtgcttggtttggtt
ctcaaatatttcgaactgatcgataaccagccttatgagctgcaagtgaaggaaacactc
actctgaagccggaagggttccgtattcaggttcgaagccgtcaaggcgggacggctctc
ctggtaccgggtggcggtcaagttgcttcgctcgaatcgaagaagcgggatgatgccaag
tccgatccttcggcggcatttgcccatcatacgccgctgctcgcattgtacggttccaat
ctgggcacggctgagggaattgccagagaggtggcggatgctgcgaagcaccaagggttc
gacagccaggtgggcacactggacgaatatgcaggaaaacttccgaaggaaggcgttgta
gtcatcgttactgcatcgtacaacggacaaccgccttccaatgccaaggctttcatggaa
tggctcgagaacgcgaacgaatccgaaattgagggcgttcgttacgcggtattcgggtgc
ggagaccataactgggcaagcacgtatcagcgcattccccgcctcatcgacgagcagctt
tcactcaaaggggggcagcgtttgatccaccgcggcgaaagtgatgcaagcggcgatttt
gagcgggaagtcgatgagtggacggagcatttatggccggatttgatgcaatcgctcgga
ttgccggttacggcggtccatggacagaaacgcagcgccttgtccgttcagttcgtccag
ggtacggccgccgttccgttgacggaaacctatcgcgccgtgacggggcgtatcgtattt
agccgcaatttgcagcatgagggcagcggaaggatcacgcagcatatcgaaatctcgctc
ccgccgggaacagaataccgcgaaggcgatcatctgggtgtgcttccggtcaatccaaag
acactggttcagcgagtacttcgaagattcaaactgaacgcgggttcccatcttattttg
tctgccgaaggaagaagcggagcgcatttgccgaccggcatacctgtccgccttgacgat
ctgctgtcccgcagcgtggaactgcaggaaccggctacaatggcacagatacgggaaatg
gccgctagcacggtatgtccgccgcatgccaaagagcttcaagaacttatagaggaagcg
agctatcaggccgaagttcgggccaaacggatcaccatgctcgacctgctggagcggtat
gaagcctgcgaactgccgtttgaacggtttcttgagcttctgccgccattgaagccgaga
tattattcgatttccagctcaccgaaagttagccggaatacggcaagcgtcacggttagc
gtcgttcgggaccgggcatggagcggcaagggagaatatcggggcattgcttcgaactat
ttggccgaattggaaacgggcgcggaggtcttgatgtttatacgctctcccgagtcgggt
tttgcgctgccggaggatccggcgacgcctatgatcatgatcggaccaggcacgggcgtt
gcaccgttcaggggatttatccaagcgagacaagcgcttcgggaggcaggtcaagagctg
ggcgccgcgcatctgtacttcggctgccggaatccggagcaggacttcctgtatcgcgag
gagtttgagcgggcagagcaggaggggctggtcacgttgcatacggctttctcgagggta
agcggagcggagaaatgctatgttcagcatttgatgaaacaagacggaatgttattgctt
tcgctgcttgagggcggagcgcaaatgtacatttgcggcgacggctcccggatggctccg
gaggtggaacaaacgctgattcaatcctatcaggagcgccatggcgtgaatgctgaagat
gctgctgcctggctgtcgggtttggaatcgacaggacaatatgtaaaagacgtatgggct
ggttga

DBGET integrated database retrieval system