KEGG   Paenibacillus sp. Y412MC10: GYMC10_2853Help
Entry
GYMC10_2853       CDS       T01100                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GYMC10_2853
Enzymes [BR:gym01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     GYMC10_2853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3269402..3270694
Genome map
AA seq 430 aa AA seqDB search
MNQDFMHPADQLLLFINRIYNHGMTTTSGGNLSIRDHNGDIWITPAGVDKGSLNRSDMVC
VKEDGRVEGIHKPSSEFPFHRLIYQARPDLKSIIHAHPPALVSFSIVRRIPDTRLLPNER
QICGEIGIAPYALPGSEQLGENIAAVFKRGIDTVMLENHGVVVGGEDLFQAFRRFETLDF
CARLEIEARRIGKPVLLTDEDYETVRNKSTLQMDTFIRDSCTSEEKELRRDMCGLMKRAY
KQGLFTSTQGTFSHRLQGNDFVITPYGKDRNDLEPEDLVRIENGKAEAGKQPSKSVLLHE
AIYNTQPHVHSVIIAHPPNIMAFAVTDTAFDSRTIPESYILLRGTPKLPFHAVYNEPERT
ASLFKANTPIAIVNNNCVIVAGQSLLNAFDRLEVAEYSAKSILSARTLGDVIHIDDERIR
ELEAAFHLES
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggattttatgcatccggcagatcagcttcttctctttatcaatcgcatttac
aaccatgggatgaccaccacgtcggggggcaatttgtcgatcagggaccataacggggat
atatggattacgccagcgggagtggacaaagggtcgcttaaccggtcggatatggtatgc
gtgaaggaggacggcagggtagagggaattcacaagccttccagcgaatttccctttcat
cggctcatttatcaagcccgcccggatttgaagtcgatcattcatgcccatccgcctgca
ctggtttcgttcagcatagtaaggcgcattccggatacaaggctgcttccgaacgaaagg
caaatttgcggcgagatcggaatcgcgccttatgcgctgcccggaagcgagcagctcggg
gagaacatcgcagccgtcttcaagcgagggatcgacaccgtcatgctggagaatcacggg
gtcgtggtcgggggagaggatctttttcaagcgtttcgtcggttcgaaaccctcgacttc
tgtgcacgccttgagattgaggcacgtcgaatcggtaaaccggtcctgcttaccgatgag
gattacgaaaccgtgcgcaacaaaagcacgctgcagatggatacgttcatccgcgattcc
tgcacgtcggaagaaaaagagctgcgccgcgatatgtgcggattgatgaaacgcgcgtat
aaacagggattgttcaccagcacgcagggcaccttctcccatcgattgcaaggaaacgat
tttgtcatcacgccatatggcaaagaccgcaatgatctggaaccggaagacctcgtccgc
atagagaacggcaaagcggaagcgggcaaacagccgagcaaatccgttctcctccatgaa
gcaatctataacacgcagccgcatgtccattcggtcattatcgcgcatcctcccaacatt
atggcatttgcggtcaccgatacggccttcgattcgaggacgataccggaaagctatata
ttgcttcgcggaacgccgaagctcccctttcatgcggtgtataatgagcctgagcgtacc
gcttcgctgtttaaagccaatacgccgattgccattgtgaacaataactgcgtaatcgtt
gccggtcaaagcctactcaacgcttttgatcgattggaagttgcggagtacagcgcgaag
tccattttgtcggcgagaacgctaggcgatgtcatccacatcgatgatgaacggatccgc
gagcttgaagcagcatttcatctggaatcatga

DBGET integrated database retrieval system