KEGG   Paenibacillus sp. Y412MC10: GYMC10_3013Help
Entry
GYMC10_3013       CDS       T01100                                 

Definition
Pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:gym00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gym00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3464820..3465749)
Genome map
AA seq 309 aa AA seqDB search
MRTLVVDQSGNGDFRTVAEAIAAAPDHAVERTLIVVKNGHYKEKVTVPASKTNLCMMGES
RDGAVIFYDDSVSTLKPNGEKMTTYDTPSFTILAKDFYAENMTFANSASRLEKRGQALAL
HVEGDRAIFRNVAILGHQDTLYTPGNGRQLYDRCYIEGHVDFIFGSATAVFKDCELHSLD
RHNGFVTAASTEESQPYGYVFMNCRLTGAAPPATVSLGRPWRPHGSVIFVHTWMGSHIRP
EGWDNWRDPAKEKTARYAEYGSVGPGAESAARVEWARYLTEEEASALTVRSVLEGRDGWN
PEEVRAAVI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacattggtcgttgatcaatccggaaacggcgatttccgaacggttgcggaagcg
atcgcggcagcgccggatcatgccgtcgaacgcacgctgatcgtcgtgaaaaacgggcat
tacaaggagaaggtaacggttcccgcaagtaaaaccaatttgtgcatgatgggtgaaagc
cgggacggagccgtcatcttctatgacgattcagtgtcgaccctgaagccgaacggcgag
aaaatgacgacgtacgacacgccatccttcacgatattggcaaaagatttttatgctgaa
aatatgacctttgctaattcggccagcaggctggagaagcggggacaagcgcttgcgcta
catgtggagggagatcgcgcaatcttccggaacgtagcgatactcggccatcaggatacg
ctgtatacgccgggcaacggcagacaattgtacgatcgctgctatatcgagggacacgtc
gacttcatattcggatctgcgacagccgtgttcaaggattgcgagcttcatagtctcgat
cgtcataacggctttgtgacggcggcttccacggaagaatcgcagccttacggctacgtc
tttatgaactgcagactaaccggagccgcgcctcccgcgaccgtcagtctcggccggcct
tggaggccgcacggaagcgtgattttcgttcatacgtggatgggaagccatatccgtccg
gaaggctgggacaactggcgcgatccagcgaaggaaaaaacggcgaggtatgcggaatac
ggaagcgtgggaccgggagcggagtctgcggcccgggtagagtgggccagatatttgacg
gaagaagaggcgtcggcattgacggtacgaagcgtactggaaggccgcgacggctggaat
cccgaagaggtgcgcgcggccgttatataa

DBGET integrated database retrieval system