KEGG   Paenibacillus sp. Y412MC10: GYMC10_3013Help
Entry
GYMC10_3013       CDS       T01100                                 

Definition
Pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GYMC10_3013
   00500 Starch and sucrose metabolism
    GYMC10_3013
Enzymes [BR:gym01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     GYMC10_3013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3464820..3465749)
Genome map
AA seq 309 aa AA seqDB search
MRTLVVDQSGNGDFRTVAEAIAAAPDHAVERTLIVVKNGHYKEKVTVPASKTNLCMMGES
RDGAVIFYDDSVSTLKPNGEKMTTYDTPSFTILAKDFYAENMTFANSASRLEKRGQALAL
HVEGDRAIFRNVAILGHQDTLYTPGNGRQLYDRCYIEGHVDFIFGSATAVFKDCELHSLD
RHNGFVTAASTEESQPYGYVFMNCRLTGAAPPATVSLGRPWRPHGSVIFVHTWMGSHIRP
EGWDNWRDPAKEKTARYAEYGSVGPGAESAARVEWARYLTEEEASALTVRSVLEGRDGWN
PEEVRAAVI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacattggtcgttgatcaatccggaaacggcgatttccgaacggttgcggaagcg
atcgcggcagcgccggatcatgccgtcgaacgcacgctgatcgtcgtgaaaaacgggcat
tacaaggagaaggtaacggttcccgcaagtaaaaccaatttgtgcatgatgggtgaaagc
cgggacggagccgtcatcttctatgacgattcagtgtcgaccctgaagccgaacggcgag
aaaatgacgacgtacgacacgccatccttcacgatattggcaaaagatttttatgctgaa
aatatgacctttgctaattcggccagcaggctggagaagcggggacaagcgcttgcgcta
catgtggagggagatcgcgcaatcttccggaacgtagcgatactcggccatcaggatacg
ctgtatacgccgggcaacggcagacaattgtacgatcgctgctatatcgagggacacgtc
gacttcatattcggatctgcgacagccgtgttcaaggattgcgagcttcatagtctcgat
cgtcataacggctttgtgacggcggcttccacggaagaatcgcagccttacggctacgtc
tttatgaactgcagactaaccggagccgcgcctcccgcgaccgtcagtctcggccggcct
tggaggccgcacggaagcgtgattttcgttcatacgtggatgggaagccatatccgtccg
gaaggctgggacaactggcgcgatccagcgaaggaaaaaacggcgaggtatgcggaatac
ggaagcgtgggaccgggagcggagtctgcggcccgggtagagtgggccagatatttgacg
gaagaagaggcgtcggcattgacggtacgaagcgtactggaaggccgcgacggctggaat
cccgaagaggtgcgcgcggccgttatataa

DBGET integrated database retrieval system