KEGG   Paenibacillus sp. Y412MC10: GYMC10_3156Help
Entry
GYMC10_3156       CDS       T01100                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gym00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3637206..3639620)
Genome map
AA seq 804 aa AA seqDB search
MIEIQNKQILIDGKPQIIMCGEIHYYRLKPEDWQDRIDKLKEAGCNAVASYVPWLCHEPA
EGEFDFDGHTHPELNLIRFIDLCKENDLYFFVRPGPFIMAEMKNEGLPYWVYAKYPEIIP
VGWDGNPATTKTVDYLAPGFLEASKNWYRAVMAVVAPRLYTNGGNIIAVQLDNEIGMLAW
VSNCPDLTDNVLSDFAAWLQQRYSGEQLSARYPFSLDDAEARKIGIRSPKEAYAPELTHD
LGYYMRNRAARYVAILRSYAEEFGVKDVPFVVNIHGTDGGRGFTFPIGISQLYESYTQAP
GYLSGSDIYFGDLDMVTFQDLYIINGFMDAVHTPDQPLTSVEFNCGDSNFGETYGGRNDP
SAADFKARMCIAQGNRLLNYYLLTGGYNYRMDMPPSDGNDRIAFTGERHGFAAPISPEGE
YNYTFPRMARTNKTILAVGEKLARMNEERDDVSFAFIPDYYMTEYRYPGSERVKEILQNI
EGNRAHGAWEIMGRAMLLAGYRFGASDIQNKPLDPSATPVLALPSARYMHGHIQRKLADY
LHAGGKLLVYGELPSFDMEGKPCTILTEALGVKPLGLLRDSGHFYLSIVSEGWAAPRPEM
RAYVAQTFDVGDQTPIMRVYGSGEVTAFDAKVGAGRAIVFGNSYRCDIDLFRTALELLGA
KAGLTHDCKYHGIFMTSTATNEGERFVHVLNLDGFDKEIGIQENGQPLFGGRKLLLQSKD
GVMLPLNVTLGEVKIVYSTAEIVKVVQDRLEFRLTQPEDIIVLETDRELIPNESFTVRKE
GSRTWIVSRQHAKVNDRLTLHFVS
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaatccaaaacaagcaaatcctcatcgacggcaagccgcaaatcatcatgtgc
ggggaaattcactattaccggcttaagccggaggattggcaggaccgcatcgacaagctg
aaggaagcgggctgcaatgcggttgccagctatgtaccatggctctgtcatgagccggcg
gaaggggagttcgattttgacggtcatacgcacccggagctgaacctcatccgctttatc
gatctgtgcaaggagaacgatctgtactttttcgttagaccgggcccgttcattatggcg
gaaatgaaaaacgaaggtttgccgtactgggtgtatgccaagtatccggaaatcattccg
gtcggctgggacggaaacccggcgacgacgaagacggtcgactacctcgcgcccggattt
cttgaggccagcaaaaactggtatcgggcggtgatggcggtcgtggcgccccgtctctac
acgaacggaggcaatattattgcggtgcagctggacaatgagatcggcatgctcgcttgg
gtcagcaattgtccggaccttacggacaacgtgctaagcgatttcgccgcttggctccag
cagcggtattccggggagcagctgtctgcccgttatccgttctccttggatgacgccgaa
gcgcgcaagatcggcattcgctctccgaaggaagcgtacgcgccggagctgacgcacgac
ttaggctactacatgcggaaccgtgccgcacgttatgttgctattcttcgctcttatgcc
gaagagttcggcgtcaaggacgttccgttcgtcgttaacattcacgggacggacgggggc
cgcgggttcacgttccccatcggcatcagccagctgtatgaatcgtatacgcaggcgccg
ggatatctatcgggctccgacatctatttcggggatttggacatggtgacgttccaggat
ctttatatcatcaacggatttatggacgcggtgcatacgccggaccagccgctcacctcc
gtcgaattcaactgcggcgacagcaacttcggcgagacgtacggaggacgcaacgatcct
tcggctgccgattttaaagcccggatgtgcatcgcgcaagggaaccggcttctcaattat
tatttgctgaccggcggctataactatcggatggatatgccgcctagcgacgggaacgac
cgaatcgcctttaccggcgaacgccacggctttgccgctccgattagcccggaaggcgag
tacaactatacgttcccgcgaatggcgcgcacgaacaagacgatattggctgtcggggag
aagctcgcacgaatgaacgaggaacgcgacgacgtcagctttgcgttcattccggattat
tacatgacggaataccgttatccgggcagtgagcgcgtgaaggaaatcctgcaaaatatc
gaggggaaccgtgcgcacggcgcttgggagatcatgggacgtgctatgctgctcgccggc
tatcggttcggcgcctccgatattcaaaataagccgctcgatccttcggccaccccggta
ctcgcgctgccgtctgcccgctatatgcacggccatatccagcggaagctggccgactac
ctgcatgcgggaggaaagctgctcgtttacggcgagctgccgagcttcgatatggaaggc
aagccgtgcacgattttgacggaagcgttaggagtgaagccgcttggcctgctccgtgat
tcgggccatttctacctgtcgatcgtgtctgaagggtgggcggccccgcggccggaaatg
cgcgcatacgttgcccaaacgttcgatgtcggcgatcagacgccgatcatgcgcgtgtac
ggcagcggtgaagtgaccgcgttcgatgcgaaggtcggagcgggacgcgcgattgtattc
ggcaattcgtaccggtgcgatatcgatttgttccggacagccttggagcttctcggcgcg
aaagcggggctgacgcatgattgcaaataccacggcatctttatgacttcaacggcaacg
aacgaaggggaacggttcgtccatgtgctgaatttggacggcttcgataaagagatcggc
attcaggagaacggccaaccgttgttcggcggacgtaagctgctgctgcaaagcaaagac
ggggttatgctgccgctcaatgtgaccctcggcgaagtgaagattgtgtattccaccgcg
gaaattgtcaaagtagtgcaggaccgcctcgaattccggctgacccagcctgaagatatc
atcgtgctcgagacggatcgcgaattgattccgaacgaaagcttcacggtccgtaaggaa
ggcagcagaacatggatcgtgtcgcgccagcacgccaaagtaaacgaccgcttaacacta
catttcgtgtcatag

DBGET integrated database retrieval system