KEGG   Paenibacillus sp. Y412MC10: GYMC10_3181Help
Entry
GYMC10_3181       CDS       T01100                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC10_3181
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GYMC10_3181
Enzymes [BR:gym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GYMC10_3181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3672857..3677185)
Genome map
AA seq 1442 aa AA seqDB search
MGLRQRVIFLVIFVTAFIMVTTPSERSNAATGNMALGKTAYSSSNEVDFFGPEKAVDGGT
EHASRWSSERTDDQWFYVDLGEPVEIGRVIINWQTPAEQYQILVSDDAVSWRNVFADNRV
LVASGPGEDTIDFEPTVAQYVKFQGETRRPIEGVYYGYSFWEFEVYKGRPQLQPIMDAVK
NSIVVSEGDTLLNLPAVPEGYTLTLVNTDSLPVIDVQGNIHAPLVDTQVQLLLQIQSDSD
PTYLLTDNALVTVPGLYEQTSDRNPEPRVIPSLREWLGATGEFRLSDKSKIVIRADDEAA
LRGTADILQQDLLDLTKLSLTVEVGSPQEGDIYLMLDAAQAGLGKEGYELNIGEYASVAA
SEQTGVMFGTRTILQLLGHAADHTAMPKGQSRDYPKYPDRGFMLDVGRKFYTIEFLQDYV
KLMSYYKMNRFQIHLNDDVGDVGYFRLESEKFPGVTSKDGYYTKQQFRDLQLLGMEYGVN
VVPEIDTPGHSGAFIAYDPRLGSNNQLDIKRPETLDFIKALFDEYLDGSNPTFVGPDVHV
GTDEYFGDDKEAFRRYADMLLNHINSKGKRARLWGSLSAYDGTTPVSNNATMDIWYEPYG
SAQQAVELGYDIINTNTNLLYIVPQLYRSYLNYDFIYNEWEPNDWLETKLPYAHPQVKGG
MFALWNDVSVEKGVSMADSHQRILPSMQVLAEKLWRGNRIDRNFASFQADAARYVDPPGV
HQSHKLQIDNERQLVLDYTFDEGFADRSGNGFDGNAVNAGTEKGIFGQAMRLNGGASYVE
TPLRTLGFGWTMSMWIKPDADNPQGVVLLESPDGQLKYNIGGSGKIAITKENYVSEFNYK
LPTDRWTHVIMIGDDTGTSIFINGSEYTATLKDGSKLETFVLPVAKIGSETNAFKGLIDE
LIVRNTYLDLHGNLALHKQAESSQPESSSYTADKAVDGRGDTRWSSDWVDDTWFMVDLGE
VKNIDAVSILWQTAYGSKYRILVSEDKENWTNVVKDSNGEINGKPGRVVTTFQSTPARYV
KFEGVSRATMFGYSFEEFEVYGEEYKLGNLRPIIDLLTAIEADKLVEDHYSPEGWAQLQQ
AIRQATAAIQTAQLSRSEAEQAYAALSVARNRLTIEDVMGLIVLNVNGSITSNLYLPQKG
QFGTRIVWSSSKPDYLNANGQLLKRPSSGSGDMEVVLIATISKGAASAEKTFKIKIKALP
GSGGGGWVPTPVTPDPEEGQNGGSNPGGEDPGNGNENGSGNENGNGNGGESGGSTTVRLN
DIASHWAEASIKRAVELGFVTGYTDKTFKPNKTVSRDEFVVMLVKALKLQGANSSLDFAD
AGSIQTWAKPYIAQALASGLISGYADGTFRPKVSISRAELAAMIVRGLGLKTAEGHELSY
ADADQIPAWAKPYVAAAQEARVMNGRGDNRFAPAASATRAEAVTVILNMLDALGELKEQE
QN
NT seq 4329 nt NT seq  +upstreamnt  +downstreamnt
gtgggtttacggcagagggttatttttttagtcatatttgttaccgctttcataatggtg
accaccccttcggagaggtccaatgccgcaacagggaatatggctctagggaagacggct
tattcgtcgtcgaacgaagtggattttttcggacctgagaaagcggtcgatgggggcacc
gaacatgcaagccgctggtcttcggaaagaacggacgatcagtggttttacgttgacctg
ggtgagcctgtagaaatcggaagagtaatcatcaactggcagactccggcggagcaatat
caaattctcgtatccgacgatgcggtatcctggcggaacgtattcgcggacaaccgcgtg
ctcgtcgcgtccgggccgggtgaagatacgatcgatttcgagccgacagtggcgcaatac
gtcaaatttcaaggggagacgcgacgtcctattgagggcgtttattacggatactccttc
tgggaattcgaggtatacaaaggcagaccgcaactgcagccaatcatggacgcggtgaaa
aacagcattgtcgtctccgaaggggataccctgctgaatctgcccgctgtaccggaaggt
tatacgctgacgctggtgaacacggacagcttgccggtgatcgacgtacagggcaatatt
catgcgccgcttgtcgatactcaggttcagctgctgctgcaaatccagagcgacagcgat
ccgacatatctcttaacggataatgcgctagtcaccgtacccggtctctacgagcagacg
agcgatcggaacccggagccgcgcgtcattccttctttgcgtgagtggctgggcgcaacc
ggcgagttccgcttgtcggacaaatccaaaatcgtcatccgcgcagatgatgaagcggct
ctgcgggggacggctgacattttgcagcaggacttattggatttaacgaagttgtcactg
accgttgaggttggttctcctcaagagggagatatctatttgatgctggatgccgcgcaa
gcgggattggggaaagagggatatgagctgaatatcggcgagtatgcctctgttgctgca
tccgagcagacgggagtcatgttcggcacgagaacgatcttgcagttgctcggccacgct
gccgatcatacggcgatgcctaaggggcaatcgcgcgattatccgaaatacccggatcgg
ggctttatgctcgatgtgggccgcaagttttatacgatcgagtttttgcaggactatgtc
aagctgatgtcctactataaaatgaaccggttccagattcacctgaacgatgatgtcggc
gatgtcggttacttccgtctggagagcgagaaatttccgggagtgacgagcaaggacggc
tattatacgaagcagcaattcagagacctgcagctgcttgggatggaatacggcgtaaac
gttgtgccggaaattgatacgccgggccactccggcgcgttcattgcctacgatcctcga
ttgggcagcaacaatcagctggatatcaagcgtccagagacgctcgacttcattaaagca
ctctttgacgagtatctcgatggcagcaatccgacctttgtcggcccggatgtgcacgtc
ggcacggatgaatatttcggcgacgacaaggaggcgttccgcaggtacgcggatatgctc
cttaaccacattaacagcaaaggcaaacgcgcccgtctatggggcagtctgtcagcatac
gacggcacgacgccggtcagcaacaatgcgacgatggacatctggtatgagccgtacgga
agcgctcagcaggccgtggagctcggctacgatattatcaataccaatacgaatttgctc
tacatcgttccgcagctgtaccgcagctatttgaattacgattttatttacaacgagtgg
gagcccaacgattggctggagacgaagcttccttatgcgcatccgcaggtcaaaggcggc
atgttcgcgctctggaacgatgtgtccgtagagaagggcgtatccatggcggactctcat
cagcggatcttgccttccatgcaagtgctggcggaaaagctgtggagaggcaaccgcatc
gatcggaacttcgcaagcttccaggcggatgccgcaaggtacgtggacccgccgggtgtt
catcagtcacacaagcttcaaatcgacaatgagcggcaactcgtgctggattataccttc
gacgaaggcttcgcggaccgttcggggaacggctttgacggcaacgcggtgaatgcaggc
acagagaagggaatcttcggtcaagccatgaggctaaacggcggggccagctacgtggaa
acgccgcttcgcacgcttggtttcggctggacgatgtccatgtggatcaaaccggacgct
gacaacccgcaaggagttgtgctgctggaatctccggacggacagctgaaatacaacatt
gggggcagcggcaaaatcgccatcacaaaagaaaattacgtcagcgaattcaattataag
ctgccgaccgatcgctggacccatgtcattatgatcggcgacgacacggggacctccatc
ttcattaacggcagtgaatatacggctactctcaaagacggctccaagctggaaacattc
gttctgccggtagccaaaatcggcagcgaaacgaatgcttttaaaggcttgattgacgaa
ctcatcgtaaggaacacctacttggacctgcatggaaatctggctttgcataagcaagcc
gaatcctcgcagccggaatcctcgtcctacacggctgataaagcggtggacggcagaggg
gataccagatggtccagcgattgggtggacgatacctggttcatggtggatctaggtgaa
gtgaagaacattgatgctgtatctattttgtggcaaacggcttatggttcgaagtaccgc
attctcgtgtccgaggacaaggagaactggacgaacgttgtgaaagacagcaatggggag
attaacggaaagccgggacgagtcgtgactaccttccagagcacgccagccagatacgtg
aagttcgaaggcgtgtccagagctacgatgttcggctattcctttgaggaatttgaagtg
tacggcgaggaatataaactcggcaatctacggccgattatcgacctgttgacggctatc
gaagccgacaagcttgtggaggaccattactctcctgagggctgggcacagcttcagcaa
gcgattaggcaagcgactgcggctattcaaaccgcccagctgtcccgttctgaggccgaa
caggcgtatgcagcgctgagcgttgcgcgtaatcgtctaacgatcgaagacgtaatgggt
ctgatcgtgcttaatgtaaacggaagtatcacatccaacctttacctcccgcagaaaggg
cagttcggtacgcgcatcgtctggagcagctcaaaacccgactacctgaatgcgaatgga
cagttgttgaaacgtccgtcaagcgggtcaggcgacatggaggtcgtgctgatcgcgacg
atcagcaagggagcagcatccgcggagaaaacgttcaagatcaaaatcaaagcgctgcct
ggctccggcggcggaggatgggttccgactccagtaactcctgatccggaagaaggccaa
aacggcggttcgaatccgggaggtgaagatccaggcaatggcaatgagaacggcagcggg
aacgagaacggcaacggcaacggcggggagtccggcggatcgacaacggttcggctgaac
gatattgcgagccattgggcagaagcgtccatcaaacgggcggttgagcttggattcgta
acgggctacaccgacaagacgttcaagccgaataagacggtcagcagagacgaattcgtc
gtcatgctggtcaaagcgttgaagctgcagggtgcgaacagttcgctggacttcgcggac
gcaggttcgattcaaacctgggcgaagccttatattgcgcaggccttggcatccggcctg
atcagcggttatgcggacgggacattccgaccgaaggtttcgattagtcgagcagaactg
gcagcaatgattgttcgcggcttgggtctgaagactgcggaagggcatgagctctcttac
gcggacgcggatcaaatcccggcttgggcgaagccgtacgtggcagcagcccaggaggcg
agagtgatgaacggtcgcggagacaaccgtttcgcaccggccgcctcggcgacgagagct
gaagccgtgaccgttattctgaatatgcttgatgcacttggggagttgaaggaacaggag
cagaactaa

DBGET integrated database retrieval system