KEGG   Paenibacillus sp. Y412MC10: GYMC10_3212Help
Entry
GYMC10_3212       CDS       T01100                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00010  Glycolysis / Gluconeogenesis
gym00071  Fatty acid degradation
gym00350  Tyrosine metabolism
gym00625  Chloroalkane and chloroalkene degradation
gym00626  Naphthalene degradation
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01120  Microbial metabolism in diverse environments
gym01130  Biosynthesis of antibiotics
gym01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC10_3212
  Lipid metabolism
   00071 Fatty acid degradation
    GYMC10_3212
  Amino acid metabolism
   00350 Tyrosine metabolism
    GYMC10_3212
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GYMC10_3212
   00626 Naphthalene degradation
    GYMC10_3212
Enzymes [BR:gym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GYMC10_3212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N AlaDh_PNT_C Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: ACX65466
JGI: GYMC10_3212
UniProt: D3EFP9
Position
complement(3706096..3707097)
Genome map
AA seq 333 aa AA seqDB search
MKVITIEKYGKNVPLVLTEQPVPHIGEHDVLVEIHAASLNPIDYKIKEGKVKLLLSYKFP
LILGNDFSGVIVKVGKRVSAFKPGDEVYGRPRKSRIGTLAEYIAVHEEDIWLKPQNLNFE
EAASIPLVGLTAYQAFTDILHLQKGQKILIHAGSGGVGTFAIQLAKLMGAFVATTASDKG
YELVKSMGADLIINYKKENFEEVLTGYDAVFDTLGGAALEKSFRVLKPGGQIVSISGLPN
ARFGKEAKLGWMKTAILSIVSRKITALEKKYHTRYHFLFMKSSGAQLKVLKEYIEGGHIK
PVIDKVYHLEETAQAFSYLQGGSAKGKVVIKIK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttataaccattgagaaatacggtaaaaatgtacccttagtgttgacagaacaa
ccagtacctcatatcggagaacatgatgtgttagtggaaattcatgcagccagcttaaac
cctatcgactataaaattaaggaagggaaagtaaaactcctgctgagttacaagttccca
ctaattttaggcaatgatttctccggcgttatagttaaggttggcaaacgggtgagtgca
tttaaacctggtgatgaagtttatggcagaccacgaaagagtcgtattggcacattggcg
gaatacattgcagtacacgaggaagatatttggttaaagccgcagaatctaaactttgaa
gaagctgcatctattccactggtcggacttacggcttaccaagcctttaccgatattttg
catctccaaaagggccaaaaaattctgattcatgcaggatcaggaggcgtggggacgttc
gccattcaactggccaaattgatgggagcttttgttgcaacaacagcaagtgataaaggg
tatgagttggtcaaatcgatgggcgccgatctgatcattaattataaaaaagaaaatttt
gaagaagtgcttactggatatgacgctgtttttgatacgctaggaggagcggctttggaa
aagtcgttccgtgtcctgaagccaggaggacaaatcgtatccatctctggcttgccaaac
gcaagatttggaaaagaagcaaagttgggttggatgaaaacggccattttgtccatcgtg
agccgtaagatcacagcacttgagaagaagtaccatacaagatatcatttcctttttatg
aaatcgagtggagcacaattgaaggttttaaaagaatatattgaaggtggccacattaag
cccgttatcgataaagtgtaccatttggaagagacagcgcaagcattctcgtacctgcaa
ggcggaagtgccaaaggtaaggtagtcattaaaataaagtaa

DBGET integrated database retrieval system