KEGG   Paenibacillus sp. Y412MC10: GYMC10_3292Help
Entry
GYMC10_3292       CDS       T01100                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
gym  Paenibacillus sp. Y412MC10
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3802440..3803837)
Genome map
AA seq 465 aa AA seqDB search
MFRMSKLGRWAVTSVATAVAASVVLLLIVSYMDSRNKQAAESQAPGTLEEGAAELRGNPE
VSNGNSSAESPASANKPASTEPQAQPSVRQDIPSLHELFEEVFPIGAAIEPNQTNGPSSE
LLKKHVRWLVAENAMKPDEIQPSEGQFIWTNADRIVEYAKENNMQVRFHTLVWHTQVGAW
FFQDAEGKPMVDETDPKRREANKKLLLERLDTHVRTIVGRYKGEITSWDVVNEVIEPGDP
DGMRASEWYKIADTDYIATAFRAAREVGGPEAKLYINDYGTDNPVKRDRLFQLVKDLLEQ
GVPIDGVGHQTHIDIYGPSVDSIITSMRKFAELGLDNLVTELDMSIYAWNDRSDYGQDLP
QEILNLQAERYGKLFKAFRQNKDILSGVVFWGIADDHTWLHGFPVARTNAPLLFDQRHQP
KPAFWLLREDRVINRRYRRVEQALWINNCIAQCRLPKKRDKEKAE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
ttgtttcgtatgtctaaactcggcagatgggcggtaacatcagtggcaactgcggtggca
gcgtccgttgttctcctcttaatcgtgtcctatatggacagccgcaacaagcaggccgcg
gaaagtcaggcaccaggaacactggaggaaggagccgcggagctaagggggaaccccgaa
gtgtcgaacgggaattcgagtgccgaatccccagccagtgcaaacaaacccgcgtctact
gaacctcaagcacaaccgtctgtacggcaagatattccatcgcttcatgaactattcgag
gaggtttttccgatcggcgccgcgatcgaaccgaatcagaccaacggcccatcgtcggag
ctgctgaagaagcatgtccgctggctggtggcggagaacgcaatgaagccggatgagatc
cagccatcggaaggccagtttatatggacgaacgccgaccgaatcgtggaatatgccaag
gagaacaacatgcaagtccgtttccataccctggtctggcatacccaagtcggtgcatgg
tttttccaagatgcggaaggcaagccgatggtggatgagacagaccccaagcgccgggaa
gcgaacaaaaaattgctgctggaacgtctggatacccacgtaaggacgatcgtcggccga
tataagggcgagattacgtcatgggacgtggtgaatgaagtcattgaacccggggatccg
gacggtatgcgcgcgagcgaatggtataaaattgccgataccgattacatcgcaacggct
tttcgagcggctcgggaagtcggaggacctgaagcgaagctctatattaacgattacgga
acggataaccctgtgaaaagggaccgtttgtttcagctggtgaaagatttgctggagcaa
ggtgttccgatcgacggtgtcggacatcagacgcatattgacatctatggtccatcggtg
gattccatcatcacgtcgatgcgaaaattcgcggagcttggcctcgacaatctcgtcacc
gagctcgacatgagcatttatgcctggaacgaccgcagcgattacggccaagatctcccg
caagaaatcctaaacctgcaagccgaacgatatggcaagttgtttaaggcattccgccaa
aacaaggacattcttagcggcgtcgtattttggggcatcgccgacgatcatacctggctt
cacggttttccggtcgcacgtaccaatgcgcctttgctgttcgatcaacgacatcagccc
aaaccggcattttggctgttgcgcgaagaccgagttataaacagacgttaccgcagagtc
gagcaagcattatggataaacaattgtatagctcaatgccgcttaccgaaaaaacgtgat
aaggagaaagccgaatga

DBGET integrated database retrieval system