KEGG   Paenibacillus sp. Y412MC10: GYMC10_3530Help
Entry
GYMC10_3530       CDS       T01100                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gym01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gym00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4067547..4068467)
Genome map
AA seq 306 aa AA seqDB search
MTKKTKTIRLLMPQWQGGNNPNYSFGAELLAWLAPDNDQPLIHVPVQTYDGTPLVNENGM
NGRTQLLEQLKAAHHLIHAHKPDRIVMFGGDCLVEQAPFAYLNERYDGELGLIWIDAHSD
LVRYVGYDNGHTVPLGNLLGEGDEEFAKHVNIPLKPENVFIAGLATPTEQEAKVISEGFQ
KLGIGFAELDTDMIQRLGIRTAGTEELKNSTAPIKAWIKERGIKHLAIHLDLDVLDPKAF
RSLLFANPEEPFNLSPQGTMQLPQLLHLLKELSEETDVVGLGITEHLPWDSIYLKKLLGE
MPILNN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaacgaaaacgatacgcctgttaatgccgcaatggcaaggggggaacaac
cccaactactcttttggtgccgaactgcttgcttggctggctccggataatgatcaaccc
cttatccatgttcccgtccaaacctatgatggaacgcctcttgtaaacgagaacggtatg
aatggcagaacacagctgctcgaacagttaaaggcggctcatcatcttatccatgcacat
aagccggatcgcattgtcatgtttggcggtgattgcttggtcgaacaagctccttttgcc
tatttgaacgaacgatacgacggggagttaggtttaatctggatcgatgctcacagtgat
ttggtgaggtatgtaggctatgacaacgggcatacggtaccgcttgggaatctgttggga
gaaggggatgaggagtttgccaaacatgtgaacatccctctaaaacccgaaaacgtcttt
attgcaggattagcaacgcctaccgaacaagaagccaaggtgatctcggaaggattccaa
aagctaggcatcggttttgcggagctggacacagacatgattcagaggctgggcattcga
actgctggcaccgaggagttgaagaacagtactgcgcctattaaagcgtggattaaagaa
cgcggcattaagcacctggccattcacctcgatctggacgtgcttgatcccaaggcattc
cggtctttgctgttcgccaatcctgaagaacccttcaatttatctccccagggaaccatg
caattgccgcagctgcttcatctgctgaaagaactgtctgaagagaccgatgtcgtgggt
ttagggatcacggagcatctgccatgggattctatttatttgaagaaactgctgggtgaa
atgcctattttaaataactaa

DBGET integrated database retrieval system