KEGG   Paenibacillus sp. Y412MC10: GYMC10_3533Help
Entry
GYMC10_3533       CDS       T01100                                 

Definition
(GenBank) Endo-1,4-beta-xylanase
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
gym  Paenibacillus sp. Y412MC10
Brite
Enzymes [BR:gym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     GYMC10_3533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_11
Motif
Other DBs
NCBI-ProteinID: ACX65770
JGI: GYMC10_3533
UniProt: D3EJU7
Position
complement(4069950..4070588)
Genome map
AA seq 212 aa AA seqDB search
MIIKFSKKVMTLVLAASMSFGLFATTSNAATDYWQNWTDGGGTVNAVNGSGGNYSVTWQN
TGNFVVGKGWNTGSPNRTINYNAGVWAPSGNGYLTLYGWTRNSLIEYYVVDSWGTYRPTG
THKGTVTSDGGTYDIYTTMRYNAPSIDGTQTFAQYWSVRQSKRATGVNSSITFSNHVNAW
ASKGMNLGSSWSYQVLATEGYQSSGSSNVTVW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
attatcattaagtttagtaaaaaggtaatgacgctggtgctggcagcttccatgagtttt
ggtttgtttgcaacaacctcaaacgcagcgacggactactggcagaattggaccgatggc
ggcggaacggtcaatgccgttaacggctccggaggcaattacagcgtaacgtggcaaaat
accgggaatttcgttgtcggcaaaggctggaataccggatcgccgaaccggacgattaac
tacaatgccggcgtctgggcgccatccggcaacgggtatttgacgctctacgggtggacg
agaaactcgctgatcgaatattacgtcgttgacagctgggggacttaccggcctaccgga
acgcataaaggcaccgtaaccagcgatgggggcacctatgacatctatacaacgatgcga
tacaacgcgccctcgattgacggcacacaaacatttgcccagtattggagcgttcggcaa
tcgaagagagctacaggcgtaaactccagcatcacgttcagcaaccacgtgaacgcatgg
gcaagcaaaggaatgaatctgggaagcagctggtcttaccaggtgttagcgacagagggc
tatcaaagcagcgggagctccaacgtaacggtgtggtaa

DBGET integrated database retrieval system