KEGG   Paenibacillus sp. Y412MC10: GYMC10_3923Help
Entry
GYMC10_3923       CDS       T01100                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gym00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4495405..4496064)
Genome map
AA seq 219 aa AA seqDB search
MLNVETRNELCKYAKKIVDSGLVVGPGGNISARAGDKMYLSPSGFALEEIEPEQWIEVDI
PTGDITDMGLRPSSEVLMHLYGYRRNPDIGAMVHTHPSHCIAFTLVEQELPVMFPDQAAL
VGRTAYIPYIIPTTDLLADAVAEKVTTASSILLGNHGLVTTGRNLREAYYRTQVVEESAK
IYLSAKAAGTPVPLTDQEVDDIAALESEDYRIQLLQKMK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgtagaaacgagaaacgagctctgcaaatatgccaaaaaaatcgtcgacagc
ggactcgttgtagggcctggggggaacatcagcgccagggcaggggacaaaatgtatttg
tccccgagcggtttcgcgctggaggagatcgagccggagcaatggatcgaagtggatatc
ccgacgggcgatattaccgatatgggtctgcggccttcctccgaagtgctgatgcacctg
tacggataccgcaggaaccctgacatcggggccatggtgcatacgcatccgtcccattgc
attgcctttacgctggtggaacaggagctgccggtaatgttccccgatcaggcggcattg
gtcggccgtacggcttatatcccttacatcataccaacgacggatttgctggcagatgcc
gtcgcggagaaagtgaccacggccagctccatactgctgggtaatcatggactggtcaca
accggccggaatctgcgcgaagcgtattaccggacccaagtggttgaagagagcgccaaa
atttatctgagcgccaaggcggccggcacgccggtgccgctgaccgatcaggaagtggac
gatattgctgctctggagagcgaggattatcggattcagcttctgcagaagatgaaataa

DBGET integrated database retrieval system