KEGG   Paenibacillus sp. Y412MC10: GYMC10_3923Help
Entry
GYMC10_3923       CDS       T01100                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00051  Fructose and mannose metabolism
gym01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GYMC10_3923
Enzymes [BR:gym01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     GYMC10_3923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACX66152
JGI: GYMC10_3923
UniProt: D3E5B1
Position
complement(4495405..4496064)
Genome map
AA seq 219 aa AA seqDB search
MLNVETRNELCKYAKKIVDSGLVVGPGGNISARAGDKMYLSPSGFALEEIEPEQWIEVDI
PTGDITDMGLRPSSEVLMHLYGYRRNPDIGAMVHTHPSHCIAFTLVEQELPVMFPDQAAL
VGRTAYIPYIIPTTDLLADAVAEKVTTASSILLGNHGLVTTGRNLREAYYRTQVVEESAK
IYLSAKAAGTPVPLTDQEVDDIAALESEDYRIQLLQKMK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgtagaaacgagaaacgagctctgcaaatatgccaaaaaaatcgtcgacagc
ggactcgttgtagggcctggggggaacatcagcgccagggcaggggacaaaatgtatttg
tccccgagcggtttcgcgctggaggagatcgagccggagcaatggatcgaagtggatatc
ccgacgggcgatattaccgatatgggtctgcggccttcctccgaagtgctgatgcacctg
tacggataccgcaggaaccctgacatcggggccatggtgcatacgcatccgtcccattgc
attgcctttacgctggtggaacaggagctgccggtaatgttccccgatcaggcggcattg
gtcggccgtacggcttatatcccttacatcataccaacgacggatttgctggcagatgcc
gtcgcggagaaagtgaccacggccagctccatactgctgggtaatcatggactggtcaca
accggccggaatctgcgcgaagcgtattaccggacccaagtggttgaagagagcgccaaa
atttatctgagcgccaaggcggccggcacgccggtgccgctgaccgatcaggaagtggac
gatattgctgctctggagagcgaggattatcggattcagcttctgcagaagatgaaataa

DBGET integrated database retrieval system