KEGG   Paenibacillus sp. Y412MC10: GYMC10_3943Help
Entry
GYMC10_3943       CDS       T01100                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    GYMC10_3943
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GYMC10_3943
Enzymes [BR:gym01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     GYMC10_3943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4517303..4518811)
Genome map
AA seq 502 aa AA seqDB search
MILKSLTERLILKTITGSLSVDITNLDTDSREIRPGGMFVCVPGYHVDGHDYAEQAIRNG
AVAIVAERELSGLSENVTLITVPDTRRILPILANAFYGDPTQRLKLIGITGTNGKTTTTH
MVDKILNDARRKTGIIGTLYMKIGNHAEKTLNTTPDTIQLMRYFHTMISHGGEYGVLEVS
SHGLDMGRVRGCDFQTVVFTNLSHDHLDFHKTMESYRNTKELLFAQLGNSNRDMLKKAVL
NADDDASSYYAKRTSAQIITYGIQNQADVRATHIHHTREGCAFHAETPWGSSEVNLKVHG
AHNIYNALAAMTTCLLEGIPLEEIRESLGQFAGVHGRFQEIQTGRRFGVVVDYAHNPDGL
KATLQSAKAITSGKMICVMGCRGERDRSKRPIMADIASSYADYVLFTADNPFSEDPEQIM
AEMLGGLTSRESGNWEVVLDRKEAIQRAVEMAGDEDRIIITGRGHETRYVTGSRIESFSD
EDIVMSSLQGIEQDILMMTPEP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgattctaaaatcactgacggagcggttgatccttaagacgattacgggcagtctttcc
gtggatatcacgaacctggatacagattcaagagaaatccggccaggcggcatgttcgtc
tgcgttccgggatatcacgtggacggccacgattacgccgagcaggcgatacgaaacggg
gctgtagccatcgtggccgagcgggagctttcgggactgtctgaaaacgtaacactgata
accgtaccggacaccagaagaatcctgccgattctcgcaaacgctttttatggcgatcct
acgcagcgtttgaaattgatcgggattaccgggacgaacggcaagacaacgacgacccat
atggtagataaaatacttaacgacgcccgccgcaaaacagggatcatcggcaccttgtat
atgaaaatcggaaatcatgcggagaagacgctgaatacaacgccggatacgatccaactt
atgcgttattttcatacgatgatctcgcatggcggagaatacggtgttctggaggtatct
tcgcacggattggatatgggcagggtccgcggatgcgattttcagaccgtcgtcttcacg
aatttatcgcatgatcatctggatttccataagacaatggagagctatcgcaatacgaag
gagctgctgttcgcccaactgggcaacagtaaccgtgacatgctgaagaaggccgtcttg
aacgctgacgatgatgcatcctcttattacgctaaacgcacatccgctcagatcataacc
tatggcattcagaatcaggcggatgtccgggcaacgcacattcatcacacaagggaaggc
tgcgcctttcatgcagaaacgccttggggaagcagcgaagttaatctgaaggtgcatgga
gcacacaacatttacaacgcgctggccgccatgacgacctgcctgctggaagggataccg
ctggaagaaatccgcgaaagtttgggacaatttgcaggggttcatggccggtttcaagaa
atacaaacaggacgccgttttggcgtggtggtcgattatgcgcataatccggacggtctt
aaggcaaccttgcaatccgccaaggccattacttcaggcaaaatgatatgcgtgatgggc
tgccggggcgagcgggaccgatcgaaacggccgatcatggccgatattgcatcttcgtat
gcggattatgtattgttcacggccgacaatccgttttcggaggatccggagcagatcatg
gccgagatgctgggcggcttaacttcccgcgaatcgggaaactgggaggttgtcttagat
cgcaaagaagcgattcaacgcgcagtggaaatggccggtgacgaggacaggattattata
accggacgagggcacgaaacccgttatgttacgggcagccggatcgaatcgtttagcgat
gaggatatcgtgatgagttctttgcagggcatagagcaggacatcctgatgatgacaccg
gaaccctaa

DBGET integrated database retrieval system