KEGG   Paenibacillus sp. Y412MC10: GYMC10_4028Help
Entry
GYMC10_4028       CDS       T01100                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC10_4028
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GYMC10_4028
  Amino acid metabolism
   00310 Lysine degradation
    GYMC10_4028
Enzymes [BR:gym01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GYMC10_4028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4602427..4603701)
Genome map
AA seq 424 aa AA seqDB search
MSEITVPAMGESITEGTIFKWHVKEGDSINIGDVLLELETDKVNLEISAESEGVVEKILR
QEGENVTIGEVIGQISPQEGVASASAPKAAEAPASVQTEAASAPAAEAPKPQAPVPAQNE
EGAGLTASPSARKLARERGIDLDQVQGRDPIGRIYHDDVKNHNEAKPSAAPSKPAASTPA
PAAQAPAAEYGKPVERTRMSRRRQTIANRLVEAQHTAAMLTTFNEVDMTAILDVRKRRKQ
AFQEKHDVGLGFMSFFTKAVVGALKRFPHLNAEIDGDDIVVKKFYDIGIAVSAKEGLVVP
VVRDADRLGFAEIEKEIGNLAAKARNNALSLSELQGGTFTITNGGVFGSLLSTPILNTPQ
VGILGMHKIQLRPVAIDAERMENRPMMYIALSYDHRIVDGSEAVRFLVTVKELLEDPESL
LLEG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaattactgtaccagctatgggcgaatccatcaccgaaggaacgatattcaaa
tggcacgtaaaagaaggggatagcatcaacatcggtgatgtgctgctcgagttagaaacg
gataaggttaatcttgaaattagcgcagagtctgaaggcgttgtggaaaaaatccttcgt
caagaaggggagaacgtaacgatcggcgaagtgatcggtcaaatttctccgcaggaaggc
gttgcaagcgcatcggcgccgaaggcagctgaagctcctgcctccgtgcaaacggaagct
gcttcggcacccgccgcagaagcaccgaaaccacaagctccggtaccggctcagaacgag
gaaggagcaggtctgactgcatcgccatccgcacgcaaactggctcgtgaacgcgggatt
gatctggaccaggtacagggccgcgacccgatcggtcggatttaccatgatgatgtgaag
aatcataacgaagctaaaccgtctgcggcgcctagcaagccggcagcttcaacgcctgca
ccggcagcacaagcacctgctgccgagtatggcaaaccggttgaacgtacccgcatgtcc
cgccgtcgtcaaacgattgcgaatcgtttggtcgaagcgcagcatacggctgccatgctg
acgaccttcaatgaggtggatatgaccgcgatcctggacgtgcgcaagcgtcgtaagcaa
gcattccaagagaagcatgacgtagggctcggtttcatgtccttcttcaccaaagcggtc
gtgggtgcgttgaagagattcccgcatctgaacgccgagatcgacggcgacgatatcgtc
gtgaagaaattctatgatatcggtattgcggtatccgccaaagaagggcttgtcgttccg
gtcgttcgcgatgccgatcgtcttggttttgccgagattgagaaggaaatcggcaatctg
gctgccaaagcccgcaataacgcgctgtccttgtctgagctgcaaggcggtacgtttacg
attacgaatggcggcgtcttcggctcgctgttgtctacgccgatcctgaatacgcctcag
gtgggtatcctcggcatgcacaaaatccagcttcgcccggtagcgattgatgctgaacgc
atggaaaatcgtccgatgatgtacatcgcattgtcttacgatcatcggatcgttgacggt
tccgaggcggttcgcttcctggtaaccgtgaaagagctcctcgaagatccggagtcgctg
ctgctggaaggataa

DBGET integrated database retrieval system