KEGG   Paenibacillus sp. Y412MC10: GYMC10_4168Help
Entry
GYMC10_4168       CDS       T01100                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:gym02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:gym02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4749016..4750350)
Genome map
AA seq 444 aa AA seqDB search
MKPFRVLVVDDSAFMRKIFSDFIERDKSFQVVGTAENGLDAVEKVKELNPDVITLDVEMP
EMNGLDALKLIMDAGSRPVIMLSGLNEQGMRETILALEAGAFDFIRKPSISNALDIEQVR
SELMKQLNAAMQAKQRRALWEEEEQKRRSADITLPLSPKPSETTPKKKPQVKETRPAAKG
TDQRGKPAEPLRMPVSRSAGEKAAFPDVPELSGFKRKRVERKPEAESAPAVLPKNESRPP
REANAQPSTDLKDLVAVGCSTGGPRALKAFLEQIPGDFHAPIVIVQHMPPNFTKSLAQRL
NSFSQLEVMEAEHGMVLEPGKAYIAPGGSHMRVHRPEGGAYQIRISQDETRNGHRPSVDV
LFESLLPLTSVKRHAVLMTGMGSDGARMMKELYDAGVTSTFAESEQTCVVYGMPRSAVEL
GCVSHVLPLHEIAPRMVQAVNNGK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaagccttttcgtgtgctcgtcgtggacgattccgcatttatgaggaaaatcttttcc
gatttcatcgagcgcgacaagtcattccaggttgtcgggacagccgagaacgggcttgac
gctgttgagaaagtaaaggaactgaatcctgacgtcattacgctggatgtagaaatgccg
gaaatgaacgggctggatgctttgaaactcattatggatgcgggatcccggccggttatc
atgttatccggccttaatgaacaaggcatgagggagaccattcttgccctcgaggcagga
gcgtttgattttatacgaaagccttccatatcgaatgcgcttgatattgagcaggtgcgt
tccgaattgatgaagcagctgaatgcggcgatgcaggctaaacagcggagggccttgtgg
gaagaagaagagcagaaacggcggagtgcggacatcacgcttcctctttcgccaaagcct
tctgagacgacgccgaaaaagaagccgcaggtgaaagaaacgagaccggcggccaaagga
acggatcagcgcggcaagccggctgagccgcttcgcatgccggtatcccgctcggccggg
gagaaggcggctttcccggatgtaccggagctttccggtttcaagcgaaaacgggttgaa
cgcaaacctgaagcggagtcggcgccagccgtgcttcccaagaacgagagccgcccgccg
agagaggcaaatgcccagccgtcaaccgacctgaaagatttggtggcggtcggctgctca
acgggtggcccaagagcattaaaagcttttctcgagcaaattcccggcgacttccatgcc
ccgatcgtcatcgttcagcatatgccgcccaatttcaccaaatcgcttgcccagcgcctg
aattcattcagtcagctggaggtcatggaagcagaacacggcatggtattggagccgggc
aaggcatacattgccccgggcggcagccacatgagggttcatcgcccggaaggcggtgca
taccaaatcaggataagtcaggatgaaacccgcaacggccatcgcccgtcggtggatgtg
ctgttcgaatctctgctgccgttgacctcggtcaagcggcatgccgttttgatgaccggc
atggggagcgatggagcgagaatgatgaaggagctttacgatgccggcgtgacatccacc
ttcgccgagagcgagcaaacctgcgtcgtatacgggatgccgagatctgccgtcgagctg
ggatgcgtaagccacgttttgccgcttcatgaaattgcaccgaggatggttcaagctgta
aataacggaaagtga

DBGET integrated database retrieval system