KEGG   Paenibacillus sp. Y412MC10: GYMC10_4168Help
Entry
GYMC10_4168       CDS       T01100                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gym00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GYMC10_4168
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GYMC10_4168
Enzymes [BR:gym01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GYMC10_4168
Two-component system [BR:gym02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GYMC10_4168
Bacterial motility proteins [BR:gym02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GYMC10_4168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4749016..4750350)
Genome map
AA seq 444 aa AA seqDB search
MKPFRVLVVDDSAFMRKIFSDFIERDKSFQVVGTAENGLDAVEKVKELNPDVITLDVEMP
EMNGLDALKLIMDAGSRPVIMLSGLNEQGMRETILALEAGAFDFIRKPSISNALDIEQVR
SELMKQLNAAMQAKQRRALWEEEEQKRRSADITLPLSPKPSETTPKKKPQVKETRPAAKG
TDQRGKPAEPLRMPVSRSAGEKAAFPDVPELSGFKRKRVERKPEAESAPAVLPKNESRPP
REANAQPSTDLKDLVAVGCSTGGPRALKAFLEQIPGDFHAPIVIVQHMPPNFTKSLAQRL
NSFSQLEVMEAEHGMVLEPGKAYIAPGGSHMRVHRPEGGAYQIRISQDETRNGHRPSVDV
LFESLLPLTSVKRHAVLMTGMGSDGARMMKELYDAGVTSTFAESEQTCVVYGMPRSAVEL
GCVSHVLPLHEIAPRMVQAVNNGK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaagccttttcgtgtgctcgtcgtggacgattccgcatttatgaggaaaatcttttcc
gatttcatcgagcgcgacaagtcattccaggttgtcgggacagccgagaacgggcttgac
gctgttgagaaagtaaaggaactgaatcctgacgtcattacgctggatgtagaaatgccg
gaaatgaacgggctggatgctttgaaactcattatggatgcgggatcccggccggttatc
atgttatccggccttaatgaacaaggcatgagggagaccattcttgccctcgaggcagga
gcgtttgattttatacgaaagccttccatatcgaatgcgcttgatattgagcaggtgcgt
tccgaattgatgaagcagctgaatgcggcgatgcaggctaaacagcggagggccttgtgg
gaagaagaagagcagaaacggcggagtgcggacatcacgcttcctctttcgccaaagcct
tctgagacgacgccgaaaaagaagccgcaggtgaaagaaacgagaccggcggccaaagga
acggatcagcgcggcaagccggctgagccgcttcgcatgccggtatcccgctcggccggg
gagaaggcggctttcccggatgtaccggagctttccggtttcaagcgaaaacgggttgaa
cgcaaacctgaagcggagtcggcgccagccgtgcttcccaagaacgagagccgcccgccg
agagaggcaaatgcccagccgtcaaccgacctgaaagatttggtggcggtcggctgctca
acgggtggcccaagagcattaaaagcttttctcgagcaaattcccggcgacttccatgcc
ccgatcgtcatcgttcagcatatgccgcccaatttcaccaaatcgcttgcccagcgcctg
aattcattcagtcagctggaggtcatggaagcagaacacggcatggtattggagccgggc
aaggcatacattgccccgggcggcagccacatgagggttcatcgcccggaaggcggtgca
taccaaatcaggataagtcaggatgaaacccgcaacggccatcgcccgtcggtggatgtg
ctgttcgaatctctgctgccgttgacctcggtcaagcggcatgccgttttgatgaccggc
atggggagcgatggagcgagaatgatgaaggagctttacgatgccggcgtgacatccacc
ttcgccgagagcgagcaaacctgcgtcgtatacgggatgccgagatctgccgtcgagctg
ggatgcgtaagccacgttttgccgcttcatgaaattgcaccgaggatggttcaagctgta
aataacggaaagtga

DBGET integrated database retrieval system