KEGG   Paenibacillus sp. Y412MC10: GYMC10_4291Help
Entry
GYMC10_4291       CDS       T01100                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gym00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4880332..4881822)
Genome map
AA seq 496 aa AA seqDB search
MEKYILALDQGTTSSRAILFNREGQIVHSAQREFPQYFPKPGWVEQNANEIWGSILAVIA
TCLSEAGVKTEQIAGIGITNQRETAVVWDRKSGEPIYPAIVWQSRQTAGICEELIAAGHD
ATVREKTGLLIDPYFSGTKIKWILDHVDGARERAKRGEIIFGTIDTWLIWKLSGGQVHVT
DYSNASRTMLYNIHELKWDEELLQLLDIPKAMLPEVRPSSEIYSNTASYHFFGREVPIAG
AAGDQQAALFGQTCFSEGMVKTTYGTGSFMLMNTGDKPVQSEHGLITTIAWGLDGRVQYA
LEGSVFVAGSAIQWLRDGLRMFREAKDSEPYARRVQSTEGVYVVPAFVGLGSPYWNSDVR
GAVFGLTRGTSKEHFIRATLESLAYQTRDVLSVMEEDSGFHIESLRVDGGAVSNAFLMEF
QSDILNVPVEVPDITETTALGAAYLAGLAVGFWKDQEEICSKWRTGQSFTPTMEENAREQ
LYGGWKKAVYAAMAFH
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
ttggagaagtacattctggcgcttgaccaaggaacgacaagctcgcgcgcgatcctgttt
aaccgcgaagggcaaatcgttcactccgctcaaagggaatttccgcagtattttccgaag
cccggttgggtggagcagaatgccaacgaaatatggggctcgattctggcggtcattgcg
acttgcttatccgaagcgggcgtgaagacggagcagattgccggcatcggaattacgaat
cagcgggagaccgccgtggtatgggaccgcaagagcggtgaaccgatctatcccgccatc
gtatggcaatctcgccagacggccggcatatgcgaggagctcattgcagcaggccatgac
gcgacggttagggagaagacgggacttctgatcgatccctatttctcgggaacgaagatc
aaatggatcctcgatcatgtggacggcgcgcgcgaacgggccaagcgaggagagattata
ttcgggaccatcgacacctggctgatctggaagctgtcgggcggccaggtgcatgtaacc
gattattccaacgcatcgcgtacgatgctctataacatccacgaattgaaatgggatgag
gagctgctgcagctgctggacatccccaaggccatgctgcctgaggtcaggccgtcatcc
gaaatctattccaatacggcatcctatcacttcttcgggcgagaggttccgattgccgga
gcggccggcgatcagcaagcggcgctgttcggccagacctgcttctccgaaggcatggtg
aagacgacctacggaacaggcagctttatgctgatgaataccggcgataagccggttcaa
tccgagcatgggctgatcaccacgatcgcctggggactggatggccgcgtacaatacgcg
cttgagggcagcgtcttcgtggcgggctccgcgatacagtggctgcgcgacgggcttcga
atgttccgcgaagccaaggacagcgagccctatgcaagacgggtccaatccaccgaaggc
gtctatgtggtgccggcttttgtcggtcttggcagtccgtattggaacagcgatgtgcgg
ggggcggtcttcggcctgacgcgaggcacgtcgaaggagcatttcatccgtgcaaccctc
gagtcgcttgcatatcaaacgcgcgatgtcctatccgtgatggaagaggattcgggcttt
catatcgaatccctgcgggtggatggaggagcggtgtccaacgcctttcttatggaattc
caaagcgacatcctgaacgtcccggtggaagtgccggacattacggagacaacggcgctc
ggtgcagcttacctggcagggctcgcggtcggcttctggaaggatcaggaggagatatgc
agcaagtggagaacggggcagagcttcacaccaaccatggaggaaaacgcaagagagcaa
ttatacggcggctggaaaaaagccgtttatgcggcaatggcttttcattag

DBGET integrated database retrieval system