KEGG   Paenibacillus sp. Y412MC10: GYMC10_4310Help
Entry
GYMC10_4310       CDS       T01100                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYMC10_4310
   01230 Biosynthesis of amino acids
    GYMC10_4310
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC10_4310
  Energy metabolism
   00680 Methane metabolism
    GYMC10_4310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYMC10_4310
Enzymes [BR:gym01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GYMC10_4310
Exosome [BR:gym04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GYMC10_4310
  Exosomal proteins of melanoma cells
   GYMC10_4310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4900962..4901534)
Genome map
AA seq 190 aa AA seqDB search
MTMIYFVRHAESPFIEGKERSRGLSAQGSLAAERVKEMLRDEGIDAILSSPYQRAKDTVQ
PLADALGLPIAEQEDLRERMAGDLQGHSFLDAKKKLFQDSAFSFPGGESGKAAQSRAIRA
FEIILNAYGGKRVAIGTHGDIMTLMLQHYDERFDYHFWLGTTLPDIYCAEFEEGRLVNLA
RLWSEHQEEG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgatatattttgtgagacatgcggaatccccatttatcgaggggaaggaacgg
tctcgtggattgtcggcccagggatcgcttgctgcggagcgagtgaaggagatgctgcgg
gatgaagggattgacgcgatcctgtcgagcccttatcagcgagccaaggacacggtccaa
ccattggcggacgctttaggattaccgattgcggagcaggaggacttaagagaacggatg
gccggcgatttgcagggacattctttccttgatgccaaaaagaaactgttccaggattcg
gccttctccttcccgggaggggaatccggtaaagccgcgcaaagccgtgcgatccgggcc
ttcgagatcattttgaatgcatatggaggcaagcgggtagcgatcgggacgcacggcgat
atcatgacactcatgctccagcattatgatgagcgcttcgattatcatttttggctggga
accacattgcctgatatttactgcgccgaatttgaggaagggcggcttgtgaacctcgcg
cggttatggagcgagcatcaagaggaaggatga

DBGET integrated database retrieval system