KEGG   Paenibacillus sp. Y412MC10: GYMC10_4314Help
Entry
GYMC10_4314       CDS       T01100                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GYMC10_4314
Enzymes [BR:gym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GYMC10_4314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4903926..4904837)
Genome map
AA seq 303 aa AA seqDB search
MRKLVVIGSINMDVVSNVAQFPQPGETIHSRDAQFFPGGKGANQAVAAALAGADCSMVGA
VGLDPFGSTLVASLEERGVGVSSVLTKAGTSGIAIITVNEEGENYIVLSEGANGRLTEED
VAAEVNWDGVHAVLLQNEIPWQTTQHVIRSASKAGVRVWLNPAPARTIPHEVFPLLDTLI
VNETEAGVVSGLRVEDAASAEAAAASIIGRGTSNVIITLGELGCFYGNARGERFNVPAFR
VKPVDTTAAGDTFIGAYAAACTEGLDTEAALRFATAAAALTVTRPGAQSSIPAKEEIVAF
MNT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaagctggttgtcattggaagcatcaatatggatgttgtgagtaatgtagcgcag
tttccccagccgggggagacgattcatagcagggacgcacagttttttcccgggggcaaa
ggggcaaatcaggctgtggccgcagccttggcaggtgccgattgcagcatggtcggcgcc
gtgggcctggatccttttggaagcactttggttgcttccttggaggagcgcggcgttggc
gtctcgtccgttctcaccaaggcaggcacatcgggaatcgcgatcatcacggtcaacgaa
gaaggcgagaactatatcgtgctctcggaaggagccaatgggcggctgaccgaagaggat
gttgccgccgaagtgaactgggacggcgtacatgcggtgctgctgcagaatgaaattccg
tggcagacgacacagcatgtcatccgatcggccagcaaggcaggcgttcgcgtctggctg
aatccggcccccgcgcgaacgattccgcacgaggtgtttccgctgctggatacattgatt
gtaaacgaaacagaagcaggcgtggttagcgggctgagggtggaggacgcagcttcggcc
gaggctgctgcagcatcgatcatcggaagaggcacctccaacgtgatcatcacccttggc
gagttagggtgcttctatgggaatgcacgcggagagcgttttaacgttccggctttccgc
gtcaaacccgtggataccacggcggcaggggataccttcatcggtgcttatgcggcagct
tgcacggaggggctggatacggaagcagccctgcggtttgcgaccgcagctgctgcattg
acggtgacccgtccgggtgctcaatcctccataccggctaaggaagagattgtggcgttt
atgaatacatga

DBGET integrated database retrieval system