KEGG   Paenibacillus sp. Y412MC10: GYMC10_4397Help
Entry
GYMC10_4397       CDS       T01100                                 

Definition
(GenBank) glycoside hydrolase clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00052  Galactose metabolism
gym00561  Glycerolipid metabolism
gym00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GYMC10_4397
  Lipid metabolism
   00561 Glycerolipid metabolism
    GYMC10_4397
   00600 Sphingolipid metabolism
    GYMC10_4397
Enzymes [BR:gym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     GYMC10_4397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C GHL10 Melibiase_2 DUF5511
Motif
Other DBs
NCBI-ProteinID: ACX66622
JGI: GYMC10_4397
UniProt: D3E829
Position
complement(4980489..4982600)
Genome map
AA seq 703 aa AA seqDB search
MTIQYQEQFRVFAIQTDNSSYLFGINDSGNLQHLYWGESVAIEDAAPLLRPRSHSSFDAE
VHSEVEEYSFWGGVKYSEPSLKVRMPDGVRDLAVRYAGHRTLRTEGRETLVIVMKDEAYP
LEVELSYRAIPECDLIERSARIVNRGEADIVLENAQSAAWVIPYLADYRLTHVTGKWSGE
FQLRSTFLTEGKKVLESRRGFTDSHANPWFAMDDGHATESAGQVWFGALAWSGNWKITAE
RTVFEHVRVTGGINDFDSEWVLGAGEAFDTPSFVGGYSSGGFGGMSRQLHRYQYSDVLPG
RETRPVLYNSWEATYFDVNAKDQMALAERAARLGVELFVVDDGWFGGRNHDRAGLGDWFV
NREKFPNGLGELINRVHELGMDFGIWVEPEAVNPDSDLYREHPDWVYHFETRERSELRNQ
LLLNISKPEVKAYILQFMTDLLEKHDIKFIKWDMNRTVTEPGMKDHPLHCQKEIWIRHVQ
SLYEIWAELRRKFPHVAFETCAGGGARIDLGIFRYADQSWPSDNTDAFDRLSIQEGFSYT
YAPRMMTCWVTESPTGMNRRQVSLKYRFHSAMMGTLGIGSNLNEWSDELIAQSAEYVAQY
KSIRHLVQFGSQYRLDSLRHKGVTAVQYGSEDGSDNVLFAFLHSQKLGEPLPRLRLTGLQ
ADQSYAIEGLAGTWSGRALMNIGIELPLRGDFDSLVYRIQKLG
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattcaataccaagaacagtttcgcgtgtttgcgatacaaaccgataacagctcc
tatctgttcggcatcaacgacagcggcaatctgcagcatctctactggggggagtccgtc
gcgatcgaagacgcggcgccgctgctgcggccgagatcgcacagctcgtttgacgcggaa
gtccattcggaggtggaggaatacagcttctggggcggcgtcaaatacagcgagcccagc
ctgaaggtccgcatgccggatggcgtgcgcgacttggcggttcgttatgccgggcaccgc
acgctgcggacggaaggcagggagacgctggtcatcgtcatgaaggatgaagcgtacccg
ctggaagtggagctgtcctaccgggcgattcccgagtgcgacctgatcgaacgctcagcc
cgaatcgtaaatcgcggcgaggcggatatcgtgctggagaacgcgcaatccgcagcttgg
gtcatcccctatctggcggattaccgcctcacgcacgtaacaggaaaatggtccggcgaa
tttcagctgcgcagcaccttcctcaccgaaggaaagaaggtgctggaatcccgcaggggt
tttacggatagccacgctaacccttggtttgcgatggatgacggacatgccacggagtcg
gcgggtcaggtatggttcggcgcgctggcctggagcgggaactggaagatcacggccgag
cggacggtgttcgagcatgttcgggtgaccggaggcatcaacgatttcgacagcgagtgg
gtgctgggagcgggagaagccttcgatacgccaagcttcgtcgggggatacagcagcggg
ggctttggcgggatgagccggcagctgcatcgctatcaatattcggatgttctgccgggc
cgcgaaacgagacctgtcctgtataactcctgggaggcgacgtacttcgatgtcaatgcc
aaggatcaaatggctttggccgaaagagccgcgcgtctgggcgtggaattgttcgtcgtg
gacgacgggtggttcggcgggcgcaaccacgaccgcgccgggcttggcgattggttcgtg
aaccgggagaaattcccgaacggccttggcgagctgattaaccgggtgcatgagctgggc
atggatttcggcatctgggtggagccggaggccgttaatccagacagcgatctgtaccgg
gagcacccggattgggtctaccatttcgagacgcgggagcgctcggagcttcgcaatcag
ctgctgctgaacatttcgaagccggaggttaaggcatacattttgcagtttatgacggac
ctgctggagaagcatgacatcaagttcattaaatgggatatgaaccggaccgtaactgaa
cccggcatgaaggatcatccgcttcactgccagaaggaaatctggattcgccacgttcag
agcctgtacgagatttgggcggagctgcggcgcaagttcccgcatgtggcgtttgaaacc
tgcgccggcggcggagcgcgcatcgatcttggcatcttccggtatgccgaccaatcctgg
ccgagcgataatacggatgcctttgaccgcctcagcattcaggagggcttctcgtacacg
tatgctccgcggatgatgacctgctgggtgacggagtcgccgactgggatgaatcgccga
caggtctccctgaagtatcgcttccacagtgcgatgatgggaacgctcggcatcggctcc
aacctgaatgaatggagcgatgagctgattgctcaatcggctgagtatgtggcgcagtac
aaatccattcgccatctggttcagttcggcagccagtatcgcctggactcgcttcggcat
aaaggcgtaacggccgtgcagtacggcagcgaagacggcagcgacaacgtgctgtttgcg
ttcctgcacagccagaagctgggcgagccgctgccgagactgcggctgaccgggctgcaa
gccgatcagtcgtatgccattgaggggttggccggtacatggagcggcagggcgctcatg
aacatcgggatcgagctgccgctgcgcggggattttgacagcttggtgtatcggattcag
aaactgggataa

DBGET integrated database retrieval system