KEGG   Paenibacillus sp. Y412MC10: GYMC10_4811Help
Entry
GYMC10_4811       CDS       T01100                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GYMC10_4811
  Lipid metabolism
   00600 Sphingolipid metabolism
    GYMC10_4811
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GYMC10_4811
Enzymes [BR:gym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     GYMC10_4811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5447973..5451098)
Genome map
AA seq 1041 aa AA seqDB search
MKLQVERGVAPSLAWLSDPGIFAVGRMPAHSDHRYYATIREADLLGEMPWRHSLNGSWKF
SYAHNAKERQADFYKMDVSCRGWDDIEVPGHIQLQGYGQPQYVNTMYPWDGVEFLRPPMI
SEDHNPVGSYVKYFDVPAGWQQRPLYISFQGVESAFYVWLNGEFVGYSEDSFTPSEFDLT
PYLAEGENKLAVEVYQRSTGSWLEDQDFWRFSGIFRDVYLYTVPDVHVQDLHVQTDLDET
YELGTLKVAMQLKGRPASKIVLELKDAAGNPVVRGETEASGGTASIALAAGKVKRWSAEE
PNLYTLYVSVYDASGNLVEVVPQKIGFRKFEMIDKVMHLNGKRIIFKGVNRHEFNSHRGR
CITKEDMLWDIKTLKQANINAVRTSHYPNQTLWYELCDEYGVYVIDEMNLETHGSWQKMG
AVEPSWNIPGSRPEWQDIVLDRAISMMERDKNHPSILIWSCGNESYAGEVIRNVANVFRE
KDPTRLVHYEGVFHNREYDDASDMESRMYAKPADIEQYLLNDPSKPYISCEYMHAMGNSV
GGLHKYTELERKYPMYQGGFIWDFMDQVIVKHDRYGKPFMAYGGDFDDRSTDYNFSGNGI
VYANRTWSPKMQEVKFLYQNIKLTPDRYGVTIRNENLFVGLDAYHVKYSLYHGGREIYSG
AVSTQVGPGEEGYVKLELPEAGYPAGEYALDVSLVTKKDSLWAEAGYEIAFGQFVFQVED
ALAVDDTDNASASEAERLQSGSEVSHDKPANDFRVVEGDVNIGVHGRDFSVMFSKQAGTL
ISVKYAGREMISSPPAPLFWRAMTDNDKGAGLPFDSALWYAASLTRRTESCELMEYSDCA
TVTYVYKLSVSEGIRVRVSYTVFTDGSIHVKSGYQGEPGLPKLPIFALTFKVPADYDNLD
WYANGPEENYIDRAFGARLCRFRSRAADHVSAYLVPQESGNRTGVREVSITSAQGHGLTI
KAPAAAPVEANISPYTAFELENATHHYELPNVHHTVVTIAGRQMGVGGDDSWGAPVHDEY
QLDPSTDMSFEFTICKSLIMK
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcaggttgaacggggagtagcgccaagccttgcatggttgtccgatcccggc
atattcgcggtaggcaggatgcctgcgcactccgatcaccgatactacgcaacgatacga
gaagccgatttgcttggagagatgccttggcgccacagtctgaatggaagctggaagttt
agttatgcgcataacgccaaggaacgccaagcggatttttataaaatggacgtttcctgc
agaggatgggatgatattgaggttcccggacatatccagcttcagggttacgggcagccg
caatacgtgaatacgatgtacccatgggacggtgtggagtttcttagacccccgatgatc
tcagaggaccacaatcccgtgggcagctatgtgaagtatttcgacgttcctgccggctgg
cagcagcgcccgctgtacatttcttttcagggagttgaatcggctttctatgtatggctg
aacggggagtttgtcggatacagcgaagacagctttacgccgagcgaattcgacctcacg
ccgtacttggcggaaggcgagaataagctggctgtcgaggtctatcaacgcagcaccgga
agctggctggaggatcaggacttttggcgcttttccggaatttttcgcgacgtgtatctg
tacacggtacctgacgttcatgtgcaggatctgcatgttcaaaccgatttggatgaaacg
tatgaacttggaacgctgaaggttgcgatgcagctcaagggcaggcctgcttcgaaaata
gtccttgagcttaaggatgcagcaggaaatccagtggtccggggggagaccgaagcttcc
gggggaacggcgtcgattgcgttagctgcgggaaaggttaagcggtggagcgcagaagaa
cctaatttatatacactgtacgtatccgtctatgacgcatccggaaaccttgtggaggtc
gtgccgcaaaagataggttttcgcaaattcgagatgatcgacaaggtgatgcacttaaac
ggcaagcgcattatattcaaaggcgtcaaccggcatgaatttaattcccatcgcggacgc
tgcattacgaaagaggatatgctgtgggatatcaagacattaaagcaggcgaatattaac
gccgtacggacgtcgcattatccgaatcagacgctgtggtatgagctatgtgatgagtac
ggcgtgtatgttatcgacgagatgaatttggagacacatggatcatggcagaaaatgggg
gccgttgagccatcctggaacataccaggcagcaggccggaatggcaggatatcgtgttg
gaccgtgcgatttccatgatggagagggataagaaccacccatcgatattgatctggtct
tgcggcaacgagtcttatgccggagaagtcattcggaacgttgcgaatgtttttcgggag
aaggaccctacccggctcgtgcattacgaaggggtgttccataaccgggaatatgacgat
gcaagcgatatggagagccgcatgtatgccaaaccggcggatattgaacagtatctgtta
aacgatccttccaagccctacatcagctgcgagtacatgcatgccatgggcaattccgtc
ggcggattgcataaatacacggagctggagcggaagtatccgatgtatcaaggcggcttc
atctgggatttcatggatcaggttatcgtgaaacatgatcgttacggcaagccttttatg
gcttatggaggggattttgacgaccgctcaaccgattacaacttctccggcaacggcatc
gtatatgcaaatcggacatggtcccccaaaatgcaggaagtgaaattcctgtatcaaaac
atcaagctgacaccggatcgttatggcgtcacgatccgaaacgagaatttgttcgtgggt
ttggatgcttatcatgttaaatactccctgtatcatggaggcagggaaatctatagcgga
gctgtaagcacccaggttggtcccggcgaagagggatatgtaaagctggaactgcctgag
gccgggtatccagccggtgagtatgcgctagacgtttcactcgtgaccaagaaggattcg
ttatgggcggaagccggttatgaaattgcatttggacagtttgttttccaagtggaggac
gcgctcgctgttgatgatactgacaatgcgtcagcgtcggaggcagaacgcctgcaatca
ggttcagaggtttcgcatgataagccagcgaatgatttccgtgttgttgaaggggacgta
aatatcggcgttcacggacgcgatttctccgtcatgttctcgaagcaggctgggaccctc
atatccgtcaagtatgcgggacgggagatgatctcttcgccgccggcgccgctcttctgg
agagcgatgacggataacgataaaggggccgggctgccgttcgactccgcgctttggtat
gcagcaagcctgactcgaagaacggaaagctgcgagctaatggagtactcagattgcgca
accgtgacctacgtgtataaactgagcgtatccgaaggaatacgggtgcgtgtatcctac
acggtgtttaccgatggcagcattcatgtaaagtcggggtatcaaggagagccggggctg
ccgaagctgccgatctttgctcttaccttcaaagtgccggcggactacgacaacctggat
tggtatgcaaacgggccggaagagaactatatcgatcgtgcgttcggagctagattgtgt
cgcttccgaagtcgtgcggcggatcatgtttcagcctatttggtaccgcaggaatcgggc
aatcgtacaggtgtgcgggaagtatccataacgagcgctcaaggccatggccttacgata
aaagcgccggcggcagcaccggttgaggcgaatatatcgccctataccgcatttgagctg
gagaatgcgacgcatcattatgagctgccgaacgttcaccataccgttgttaccattgct
gggcggcagatgggggttgggggtgacgacagctggggggctccggttcatgatgagtat
caactcgatccttcaacggacatgtcctttgaatttaccatttgcaaaagcctaatcatg
aaatag

DBGET integrated database retrieval system