KEGG   Paenibacillus sp. Y412MC10: GYMC10_5772Help
Entry
GYMC10_5772       CDS       T01100                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:gym00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6457390..6458853)
Genome map
AA seq 487 aa AA seqDB search
MTGEVRVRYAPSPTGHLHIGNARTALFNYLFARKNNGKFIIRIEDTDVKRNVEGGEQSQL
KYLKWLGMDWDESVDVGGEYGPYRQTERLDIYKEYWQDLLDRGLAYRCYCTEEELEQERE
EQMARGETPRYSGKHRDLTEEQRQALEAEGRVASIRFRVPEDRVYTFDDMVKGTISFNSK
ETGDFVIVKKDGIPTYNFAVALDDHLMKISHVLRGEDHISNTPRQLMIYEAFGWEPPQFG
HMTLIVGEDHKKLSKRNESIIQFIEQYDQLGYLPEALFNFISLLGWSPEGEEEVFSQEQL
ISIFDEHRLSKSPAVFDTNKLAHMNNTYIKNADPDRIADLAIPHLQKASRLPSELTAEQE
EWARALVALYQEQMTAASDIVDLSEVFFRTHLELDAEGIEVMGGEQVPAVLSAFLAKIEQ
SDEFNAQKIAAMIKEVQKETGFKGKQLFMPIRVALTGQTHGRDLNQTIWLLGRDRVLDRL
RSQIKGA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaccggagaagtccgcgtgcgctatgcaccgagtccaacgggacatttacatatcggc
aatgccagaacggcattattcaattatttattcgcccgcaagaacaacgggaaattcatt
atccgcatcgaggatacggatgtgaaacgcaacgtggaaggcggcgagcagagccagctg
aagtacttgaagtggctgggcatggattgggacgagagcgtggatgtcgggggcgagtac
ggaccttatcgccagaccgagcgtcttgatatttataaagaatattggcaggaccttctg
gatcgcgggcttgcttaccgctgctactgcacggaggaagagctggagcaggagcgggaa
gagcagatggctcggggcgaaacgccgcgctattccgggaagcatcgcgatttgaccgaa
gagcagcgccaggcgcttgaggctgaaggccgcgtggcgagcatccgcttccgcgtgccg
gaagaccgcgtctacacgttcgacgatatggtgaagggcacgatttcgtttaacagcaaa
gagacgggcgacttcgtcatcgtcaaaaaagacggcattcctacctacaatttcgcggta
gctttggatgatcatctcatgaagatcagccatgtgctgcgcggggaggatcatatctcc
aatacgccgcgtcagctgatgatctatgaagccttcgggtgggagccccctcagttcggg
catatgaccctgatcgtgggcgaggaccacaagaagctgagcaagcgcaacgaatcgatc
atccagttcatcgagcagtatgaccagcttggttatttgcctgaagcgctgttcaacttc
atctcgctgctgggctggtctccggaaggggaagaggaagtgttctcccaagagcagctg
atctcgatcttcgatgagcatcgcctgtccaagagcccggcggtattcgacacgaacaag
ctggctcatatgaataacacgtacattaagaacgcggatccggaccggatcgccgatttg
gccattccgcatttgcagaaagccagccgtttgccgtccgagcttacggccgagcaagag
gaatgggcacgcgcgctcgtggcgctctatcaggagcagatgacggcggcttcggatatc
gtggatctgtcggaagtgttcttccgcacgcacctggagctggatgccgaggggatcgaa
gtgatgggcggcgagcaggtgcctgccgtactgtccgcattcctggcgaagatcgaacag
tccgatgagtttaacgcgcagaagatcgctgccatgatcaaggaagtgcagaaggagacc
gggtttaagggcaaacagctcttcatgccgatccgcgtagccttgacgggacaaacccat
ggccgcgacttgaaccagacgatctggctgcttggcagggaccgcgtgcttgaccgtttg
cgttcccagatcaagggcgcataa

DBGET integrated database retrieval system