KEGG   Paenibacillus sp. Y412MC10: GYMC10_5819Help
Entry
GYMC10_5819       CDS       T01100                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GYMC10_5819
   00052 Galactose metabolism
    GYMC10_5819
   00500 Starch and sucrose metabolism
    GYMC10_5819
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC10_5819
Enzymes [BR:gym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GYMC10_5819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6518989..6519861)
Genome map
AA seq 290 aa AA seqDB search
MNIRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVASGIEDIIIVTGKGK
RAIEDHFDSSFELEHNLAEKGKWGLLEEVRKPSNMADIHYIRQKEPKGLGHAIWCARKFI
GDEPFAVLLGDDIVESEVPCLKQMMKVYDTYQSTIVGVQPVDWNEVDRYGIVDGSQKSDR
IYETSRLVEKPSRDEAPSNLAIMGRYILPPDIFDLLENQEVGKNGEIQLTDALSTLAHRS
PIYAYHFDGMRHDVGEKLGFIETSIHYALQREELREDLLAYLSGVLAKVQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcgtaaagcgatcataccggctgcagggcttggcacgcggttcctgccggct
acgaaagcgatgccgaaggagatgctacccattgtggacaagccgaccatacaatacatt
atcgaagaagcggtcgcttccggtatagaggacattatcattgtaacgggtaaggggaag
cgggcgattgaggaccattttgattcttcctttgagctggaacataatttagcggagaag
ggtaagtggggacttctcgaagaagtgcgtaaaccctccaacatggcggatatccactat
attcggcaaaaagagcccaaggggctgggccatgccatttggtgcgcacgcaaattcatc
ggggacgagccgtttgctgtgctgctcggcgatgacatcgtggagtcggaagtcccctgc
ctaaaacagatgatgaaggtctacgacacctaccaatctaccattgtgggcgttcagccc
gtcgattggaacgaagtcgatcgttacgggatcgtagacggatctcagaaatcagaccgg
atctatgaaacatcgcgactcgttgaaaaaccttctcgagatgaggcaccctccaatttg
gccattatggggcggtatattttgccgccggatatcttcgatttgctggagaatcaagag
gttgggaagaacggagaaatccagctgactgatgcgctttccaccttagctcatcgtagc
cccatctacgcgtatcactttgacgggatgcgtcatgatgtcggcgagaagttaggcttt
atcgaaacgagcattcattatgcattgcagcgggaagagttaagggaggatttgcttgct
tatttgagtggggttttggcgaaggtgcagtag

DBGET integrated database retrieval system