KEGG   Paenibacillus sp. Y412MC10: GYMC10_5967Help
Entry
GYMC10_5967       CDS       T01100                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:gym00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:gym00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6701079..6701558)
Genome map
AA seq 159 aa AA seqDB search
MSVYEYHATNTKGQEVSLDQYSGKVLIIANTASQCGLTPQYGELQQLYDQYGQQGLQVLG
FPCNQFGGQEPGTSEEAESFCQLNYGVNFPVFQKIDVNGEHAHPLFQYLKSEQPGPNEGG
EIAWNFTKFLVDRAGKVVQRFEPKESPESMKGAIESLLG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtttatgaatatcatgcaaccaataccaaggggcaggaagtctcgctcgatcag
tattcgggcaaggtcttgatcatcgcgaatacggcaagccaatgcggcctaacgccgcaa
tatggagagcttcaacagctgtacgaccaatacggccagcaagggcttcaggttcttggc
tttccgtgcaatcagtttggcggacaggagccgggtacgagcgaagaggctgaatcgttc
tgtcaattgaactatggcgtgaactttccggttttccagaagattgacgtgaatggggag
catgctcatccgttatttcagtatctgaaatcggagcagcccggaccgaatgaaggcgga
gagatcgcttggaattttacgaagttcctggtggaccgcgcaggcaaggtggtccagcgg
tttgagccgaaggaatcgcctgaatccatgaagggcgccattgaatccctgctgggttaa

DBGET integrated database retrieval system