KEGG   Paenibacillus sp. Y412MC10: GYMC10_6061Help
Entry
GYMC10_6061       CDS       T01100                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GYMC10_6061
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GYMC10_6061
Enzymes [BR:gym01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GYMC10_6061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6807910..6808386
Genome map
AA seq 158 aa AA seqDB search
MSIYEYEVKTIRGESQTLESYKGDVMLIVNTATKCGFAPQFDGLEKLHQTYRDQGLAVLG
FPSSQFMNQELEEDAAIEEACKLNHGVTFPLFSKIDVNGTNAHPLYKYLTSEAPGALGIK
AIKWNFTKFLVDRSGKVIKRFAPTDTPEKMEEDIKKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatctatgaatatgaagtaaaaacgatacgcggcgaatcccaaacgctggaatct
tataaaggcgacgtcatgctgatcgtcaatacggcgaccaaatgcggctttgcccctcaa
ttcgacggtctggagaagctgcaccaaacctaccgcgaccagggattggccgttctcggc
ttccccagcagccaattcatgaatcaagagctggaggaggatgccgcgatcgaagaggcc
tgcaagcttaatcacggcgtcaccttcccgctgttttccaagatcgatgtgaacggcacg
aacgctcatccgctttacaaatatctgaccagcgaagcccccggcgcactgggcatcaag
gcgatcaaatggaactttaccaaatttctggtggaccgcagcggcaaggtgatcaagcgc
tttgcaccgacggacactccggagaagatggaagaggatatcaagaagctgttgtaa

DBGET integrated database retrieval system