KEGG   Helicobacter acinonychis: Hac_0014Help
Entry
Hac_0014          CDS       T00371                                 

Gene name
trpB
Definition
(GenBank) (Q9ZJU9) Tryptophan synthase beta chain (EC 4.2.1.20); High confidence in function and specificity (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hac  Helicobacter acinonychis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hac_0014 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hac_0014 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hac_0014 (trpB)
Enzymes [BR:hac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hac_0014 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(17333..18514)
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDDKFQQEYFHLLKDFVGRPSPLTLC
QNIISNPKVRLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLNLKCVIFMGGKDIKRQEMNVFRMRLLGAEIREVNSGSATLKDAVNETLRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEAKQQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIIESHSISA
GLDYPGVGPEHSFLKESGRAIYESASDIEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCTQESIIVVNLSGRGDKDLNTVYSALKGDLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggggggagttttgtttcagaattgttagtg
cctgcgttaagagagttagaacaagcgtttgatgcttgtttaaaagatgataaattccaa
caagagtatttccatcttttaaaggattttgtgggccgccctagccctttaactttgtgt
caaaatatcatttctaaccctaaagttaggctttatctgaaacgagaggatttaatccat
ggcggagcgcataagacgaaccaagcgttagggcaagcccttttggctaaaaaaatgggt
aaaaccaggatcattgctgaaacaggcgctgggcagcatggcgttgcaacggctatcgct
tgtgcattgttaaatttaaaatgcgtgatttttatgggaggcaaagacatcaagcgccaa
gaaatgaacgttttcagaatgcgtttgttgggcgctgaaatcagagaagtcaattcaggg
agcgcgacacttaaagacgctgtgaatgagaccttaagagattgggcgagcagctacaaa
gacacgcactatttgctgggcacagccgctgggccgcacccttaccctacaatggtcaaa
acctttcaaaaaatgataggcgatgaggccaaacaacaaattctagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgccatagggatattcagc
gcgtttttaaacgataaagaggtcaaactcataggcgtagagccggcaggcttggggcta
gaaactaataagcatggagcaactttgaataaggggcgagtggggattttgcatgggaat
aaaacctatcttttgcaagatgatgaaggccaaattatagaaagtcatagcataagcgct
gggcttgattatccaggagtagggccagagcacagctttttaaaagaaagcgggcgtgcg
atttatgaaagtgcaagcgatattgaagcgctagaagcctttagtttattatgccaaaaa
gaaggcattatcccagccttagaaagctcacacgccttagcgtatgctttaaaactcgct
caaaaatgcacacaagaaagcattattgtagtgaatctgagcggcaggggggataaagat
ttaaataccgtttatagcgctttaaaaggggatttaaaatga

DBGET integrated database retrieval system