KEGG   Helicobacter acinonychis: Hac_0209Help
Entry
Hac_0209          CDS       T00371                                 

Gene name
algC
Definition
hypothetical protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hac  Helicobacter acinonychis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hac_0209 (algC)
   00030 Pentose phosphate pathway
    Hac_0209 (algC)
   00051 Fructose and mannose metabolism
    Hac_0209 (algC)
   00052 Galactose metabolism
    Hac_0209 (algC)
   00500 Starch and sucrose metabolism
    Hac_0209 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    Hac_0209 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    Hac_0209 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hac_0209 (algC)
Enzymes [BR:hac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hac_0209 (algC)
    5.4.2.8  phosphomannomutase
     Hac_0209 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(176660..178048)
Genome map
AA seq 462 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMRKYDKSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNAINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKEIQALKDTLLSTKHKIQPLKEIPEKVNALEAYHRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIEFSSLYSDPDGNFPNHHPDPSEAKNLQDLQVHMQKNAMAVGFAF
DGDADRIAMLSSHHTYAGDELAILFAKRLHAQGITPFVIGEVKCSQMMYNTINTFGKTLM
YKTGHSNLKIKLKETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPKIKGIINIDGVRVVFKHG
FGLIRASNTTPFLVTRFEGKDEKTALEYKRALLGLLQISSMK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttatccgaccactttagat
gaaaagagcgcttttagtatcggcgtggagttaggaaaaatcatgcggaaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgttttttgtttgaagctttgagc
gcggggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacgccggta
gcgtattttgcagcttttaatgcaatcaatggtatccaatgccctaactctatcatgatc
accggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggagattcaagctttaaaagacacgcttttaagcactaaacacaaaatc
caacctttaaaagaaatcccagaaaaagtcaatgctctagaagcgtatcaccgctatttg
atcaaggattttaagcatttaaagaatcttaaatacaagattgctttagattttggtaat
ggcgtgggggcgttaggactagagcctattttaaaggctttaaacattgaatttagcagc
ctttatagcgatcctgatggcaattttcctaaccaccacccagaccctagcgaagcgaaa
aacttacaggatttgcaagtgcacatgcaaaaaaacgctatggctgtaggctttgctttt
gatggcgatgcggacaggattgcgatgctaagctctcatcacacttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcattactccctttgtgataggc
gaagtcaaatgctctcaaatgatgtataacacgattaacacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaacttaaagaaaccaatgcacattttgcg
gctgaaatgagcgggcatatctttttcaaagagcgttattttggctatgatgacgctctt
tatgcatgtttaagggctttagaattattgcttgaacaaagtccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacttgcaagaagcacttaaaaacccgccaagtcat
ttccctaaaatcaaagggataattaacattgatggcgtgagagtggtttttaaacatggt
tttgggcttattcgtgcaagcaacaccaccccctttttagtcactcgctttgaaggcaag
gatgaaaaaacggcgttagaatataaaagggcgttgcttgggttgcttcaaatttcttct
atgaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system