KEGG   Helicobacter acinonychis: Hac_0209Help
Entry
Hac_0209          CDS       T00371                                 

Gene name
algC
Definition
hypothetical protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hac  Helicobacter acinonychis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hac00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hac00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hac00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hac00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hac00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hac00520]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hac00230]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:hac00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(176660..178048)
Genome map
AA seq 462 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMRKYDKSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNAINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKEIQALKDTLLSTKHKIQPLKEIPEKVNALEAYHRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIEFSSLYSDPDGNFPNHHPDPSEAKNLQDLQVHMQKNAMAVGFAF
DGDADRIAMLSSHHTYAGDELAILFAKRLHAQGITPFVIGEVKCSQMMYNTINTFGKTLM
YKTGHSNLKIKLKETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPKIKGIINIDGVRVVFKHG
FGLIRASNTTPFLVTRFEGKDEKTALEYKRALLGLLQISSMK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttatccgaccactttagat
gaaaagagcgcttttagtatcggcgtggagttaggaaaaatcatgcggaaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgttttttgtttgaagctttgagc
gcggggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacgccggta
gcgtattttgcagcttttaatgcaatcaatggtatccaatgccctaactctatcatgatc
accggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggagattcaagctttaaaagacacgcttttaagcactaaacacaaaatc
caacctttaaaagaaatcccagaaaaagtcaatgctctagaagcgtatcaccgctatttg
atcaaggattttaagcatttaaagaatcttaaatacaagattgctttagattttggtaat
ggcgtgggggcgttaggactagagcctattttaaaggctttaaacattgaatttagcagc
ctttatagcgatcctgatggcaattttcctaaccaccacccagaccctagcgaagcgaaa
aacttacaggatttgcaagtgcacatgcaaaaaaacgctatggctgtaggctttgctttt
gatggcgatgcggacaggattgcgatgctaagctctcatcacacttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcattactccctttgtgataggc
gaagtcaaatgctctcaaatgatgtataacacgattaacacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaacttaaagaaaccaatgcacattttgcg
gctgaaatgagcgggcatatctttttcaaagagcgttattttggctatgatgacgctctt
tatgcatgtttaagggctttagaattattgcttgaacaaagtccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacttgcaagaagcacttaaaaacccgccaagtcat
ttccctaaaatcaaagggataattaacattgatggcgtgagagtggtttttaaacatggt
tttgggcttattcgtgcaagcaacaccaccccctttttagtcactcgctttgaaggcaag
gatgaaaaaacggcgttagaatataaaagggcgttgcttgggttgcttcaaatttcttct
atgaagtaa

DBGET integrated database retrieval system