KEGG   Helicobacter acinonychis: Hac_0308Help
Entry
Hac_0308          CDS       T00371                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hac  Helicobacter acinonychis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
261670..262458
Genome map
AA seq 262 aa AA seqDB search
MILRASVLSVFLLVSLGAAPESPANKQMQDNLVKVIEKQTSKKVRILETKSLKSNQDLKI
VVVEDPDTKYQIPLVVSKDGNLVIGLSNIFFSNKSDDVQLVAETNQRIQTLNATQQNSAK
LNAIFNEVPADYVVELPSTNAANKDKILYIVSDPMCPHCQRELTKLRDHLKENTVKMVIV
GWLGVNSAKKAALIQEEMAQAKARGASVEDKISIIEKIYSTQYDINAQKEPEDLRTKVEN
VTKKIFEPGVIKGVPFLYHYRS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgtgttccttcttgtaagtttaggggcagcccct
gaaagtccggctaataagcaaatgcaagacaatttagttaaggtgattgaaaaacaaact
agtaaaaaggtgcgtattttagagactaaatctttgaaatccaatcaagatttaaaaatc
gtggtggtagaagacccagacactaaatatcaaatcccgcttgtggtgagtaaggatggt
aatttagtcatagggcttagcaatatcttttttagcaataaaagcgacgatgtgcaattg
gtcgccgaaaccaatcaaagaatccaaacccttaatgctacccagcaaaatagcgcgaaa
ttgaacgctatttttaatgaagtgcctgctgattatgtggtagaactaccttccactaac
gctgcaaataaagacaagatcctttatattgtctctgatcccatgtgtccgcattgccaa
agagagctcactaaactcagagaccacttgaaagaaaacaccgttaaaatggttattgtg
gggtggcttggggtcaattcggctaaaaaagcggctttgatccaagaagaaatggcacag
gctaaggctaggggagcgagcgtggaagataaaatctctatcattgaaaagatttattcc
acccaatatgatattaatgcccaaaaagagcctgaagatttacgcactaaagtggaaaat
gtcactaaaaagatttttgagcccggcgtgattaaaggcgtgcctttcttgtatcattat
aggtcataa

DBGET integrated database retrieval system