KEGG   Helicobacter acinonychis: Hac_0345Help
Entry
Hac_0345          CDS       T00371                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hac  Helicobacter acinonychis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hac00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(292842..293813)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMIRETRLDINDFIAPLFVIESDGNIKNEISSMPRVYQMSIEPLL
KECEELVSLGIKAVLLFGIPKHKDATGSHALNKDHIAARATREIKKRFKDLIVIADLCFC
EYTDHGHCGILENTSVSNDKTLEILNLQGLILAESGVDILAPSSMMDGNVLSLRNALDKA
GYFCTPIMSYSTKFASSYYGPFRDAANSAPSFGDRKSYQMDYGNQKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRNHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagactacgaagtagcgaaaatttaagggctatgataagagaa
acgcgtttagatattaacgatttcatcgcccccctatttgtcatagaaagcgatggtaat
attaaaaatgaaattagctccatgcctagggtttatcaaatgagtatcgagcctcttttg
aaagaatgcgaagagttggtgagtcttggtatcaaagccgttctattgtttggtatccct
aaacacaaggacgccacaggaagccatgcgttaaataaggatcatattgccgcaagagcc
acgagagagattaaaaaacgatttaaggatttgatcgttatagcggatttgtgtttttgt
gaatacactgaccatgggcattgcgggattttagaaaacacttctgtgtctaacgataaa
acgctagagattttaaaccttcaagggcttattttagccgaaagcggtgtggatatttta
gccccaagcagcatgatggatgggaatgttttaagcttaagaaacgcactggataaggct
gggtatttttgcacgcctattatgagctattccactaaatttgcgagcagctattatggg
ccttttagagatgcggcaaattccgcaccaagttttggcgatcggaagagctatcaaatg
gattacggcaatcaaaaagaagcgcttttagaaagtttagaagatgaaaaacagggtgcg
gatattttaatggtcaaaccggctttagcgtatttggatattgttaaagagattagaaat
cacactttactccctttagcgctctataatgtgagtggggaatacgccatgctcaaactc
gctcaaaaacacaacttgatcaattatgaaagcgtgctgttagaaacgatgacttgcttt
aaaagagcgggagcggatatgattattagctatcatgctaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system