KEGG   Helicobacter acinonychis: Hac_0382Help
Entry
Hac_0382          CDS       T00371                                 

Gene name
metK
Definition
S-adenosylmethionine synthetase (EC:2.5.1.6)
Orthology
K00789  
S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
hac  Helicobacter acinonychis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hac01230]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hac00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328425..329582
Genome map
AA seq 385 aa AA seqDB search
MKDSFLFTSESVTEGHPDKMADQISDAVLDYIIERDKKAKVACETLVSNGFCVITGELKT
SIYAPMQEIAREVVKKIGYTDALYGFDYRSAAVLNGIGEQSPDINQGVDREDGEIGAGDQ
GLVFGYACKETQMLMPLPIHLAHQLTFALAQKRKDNTLPFLRPDGKSQVSVRYENNKPIS
IDTIVISTQHSPEVSQKHLKEAVIEEIVYKVLPKEYLHDNIKFFVNPTGKFVIGGPQGDA
GLTGRKIIVDTYGGSCPHGGGAFSGKDPSKVDRSAAYAARYVAKNLVASGVCDRATVQLA
YAIGVVEPVSIYVNTHNTSKYSSAELEKCVKLVFKLTPKGIIESLDLLRPIYSLTSSYGH
FGRELEAFTWEKTNKAEEIKAFFKH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatagttttctttttacttcagaatcagtaaccgaagggcatcctgataaaatg
gccgatcaaatcagcgatgcggttttagattatattattgagcgggataaaaaagctaaa
gtcgcatgcgagactttggtttctaatggtttttgcgtgatcactggcgagttaaaaact
tctatctatgctcctatgcaagagattgcaagagaagtggttaaaaaaattggttataca
gacgctctttatggctttgattatagaagcgcggcggttttaaatggcattggtgagcaa
agccctgatattaatcaaggcgtggatagagaagatggcgagattggggcaggggatcaa
gggcttgtgtttggttatgcgtgcaaagagactcaaatgctcatgcctttacccattcat
ttagcgcaccaactcactttcgctctagctcaaaaaagaaaagacaacaccttgcctttt
ttaaggcctgatggcaagtctcaagtgagcgttcgctatgagaataacaaacccataagc
attgatacgatcgtcatttctacccaacattccccagaagtttcacaaaaacatttaaaa
gaagcggtgattgaagagatcgtgtataaggttttacccaaagaatatttgcatgacaat
atcaagttttttgtcaatcccacaggaaaattcgttatcggtggaccacaaggtgatgcg
ggtttgacaggaagaaaaatcatcgtggatacttatggggggagttgtccgcatgggggt
ggagcgtttagcgggaaagaccctagtaaggtggataggagtgcagcttatgcggcccgc
tatgtggctaaaaatttggtagcgagtggggtttgcgatagagcgaccgtgcagcttgct
tatgcgattggggttgtagagccggtgtccatttatgtgaatacgcataacacgagcaag
tattcaagcgcggaattagaaaaatgcgtgaaattggtttttaaactcacgccaaaaggc
attattgaaagcttggatttgttaagacctatttattcgctcacttcatcttatgggcat
tttgggcgcgagttggaggcattcacttgggaaaagaccaacaaggctgaagagattaaa
gcgttctttaagcattaa

DBGET integrated database retrieval system