KEGG   Helicobacter acinonychis: Hac_0431Help
Entry
Hac_0431          CDS       T00371                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hac  Helicobacter acinonychis
Pathway
hac00010  Glycolysis / Gluconeogenesis
hac00020  Citrate cycle (TCA cycle)
hac00620  Pyruvate metabolism
hac00640  Propanoate metabolism
hac00650  Butanoate metabolism
hac00680  Methane metabolism
hac01100  Metabolic pathways
hac01120  Microbial metabolism in diverse environments
hac01130  Biosynthesis of antibiotics
hac01200  Carbon metabolism
Module
hac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hac_0431 (porA)
   00020 Citrate cycle (TCA cycle)
    Hac_0431 (porA)
   00620 Pyruvate metabolism
    Hac_0431 (porA)
   00640 Propanoate metabolism
    Hac_0431 (porA)
   00650 Butanoate metabolism
    Hac_0431 (porA)
  Energy metabolism
   00680 Methane metabolism
    Hac_0431 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hac_0431 (porA)
Enzymes [BR:hac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hac_0431 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: CAJ99263
UniProt: Q17YL3
Position
complement(375393..376616)
Genome map
AA seq 407 aa AA seqDB search
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMNAPS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKSTLTHPTQQFVGLRGPKISFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtattgaattgcaagaaatagaagtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctaccctatcaccccatcgacg
cccatcgtacaaaattatggctcatttaaggataatggctatattgatggcgaatttgtt
ttagtggaatctgagcatgctgctatgagtgcatgcgtaggagcggccgctgctggagga
agggtgagcactgcgactagctctcaaggtttagcgctaatggtagaagttttataccaa
gcctctggcatgcgtttgcctattgttttaaacttggtcaatcgtgctttagcagcccct
ttaaatatccatggcgatcattctgatatgtatttgagtagggattctggctggataagt
ttatgcacatgcaaccctcaagaagcctatgatttcactttaatggcgtttaggatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagatggttttttatgctcacac
accgtgcaaaatgtccgtcccttaagcgatgcagtggcttatcaatttgtgggcgaatac
caaaccaaacattcccttttagattttgataaaccggtaagctatggagcacaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgaacgcgccttct
gtgattgaagaagtgtttaatgatttcgctaaactgacaggcaggcaataccatttaacc
aaaactttccagctagaagacgctgaaatcgctatctttgcgttagggactacttatgaa
tccgctatcgtagcagctaaagaaatgcgtaaaaaaggcattaaggccggcgtggcgacc
atccattctttacgccccttcccttatgaaagattggggcaggatttgaaaaatcttaaa
gctttagcaattttggataaaagctctccagccggtgctatgggggcgatgtttaatgaa
gtaacgagtgcggtgtatcaaacccaagggactaaacatccggtagtgtctaactatatc
tatggtttaggcgaaagggatatgacgatcgcgcatttatgcgagatttttgaagaaatc
aatgaagacgctcttaaaagcacgctcacgcaccctacccaacaattcgtaggcttgcgc
ggtcctaaaataagctttttttaa

DBGET integrated database retrieval system