KEGG   Helicobacter acinonychis: Hac_0432Help
Entry
Hac_0432          CDS       T00371                                 

Gene name
porD
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hac  Helicobacter acinonychis
Pathway
hac00010  Glycolysis / Gluconeogenesis
hac00020  Citrate cycle (TCA cycle)
hac00620  Pyruvate metabolism
hac00640  Propanoate metabolism
hac00650  Butanoate metabolism
hac00680  Methane metabolism
hac01100  Metabolic pathways
hac01120  Microbial metabolism in diverse environments
hac01130  Biosynthesis of antibiotics
hac01200  Carbon metabolism
Module
hac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hac_0432 (porD)
   00020 Citrate cycle (TCA cycle)
    Hac_0432 (porD)
   00620 Pyruvate metabolism
    Hac_0432 (porD)
   00640 Propanoate metabolism
    Hac_0432 (porD)
   00650 Butanoate metabolism
    Hac_0432 (porD)
  Energy metabolism
   00680 Methane metabolism
    Hac_0432 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hac_0432 (porD)
Enzymes [BR:hac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hac_0432 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_6 Fer4_2 Fer4_10 Fer4_9 Fer4_17 Fer4_7 Fer4_16 Fer4_15 Fer4_8 Fer4_4 Fer4_13 Fer4_18
Motif
Other DBs
NCBI-ProteinID: CAJ99264
UniProt: Q17YL2
Position
complement(376626..377018)
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEIEKHNDERHYTKQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVSVCPTNPKSLWMFEEQIEPATALTQ
WPQKEEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctattcccttttgaaaaaaacgcg
caaagcgaaatagaaaaacacaacgatgagcgccattacacaaagcaaagttacttcacc
acttcagtggctcattggcgtgtggctaagcctgtgcataataataacatttgcatcaat
tgctttaattgttgggtttattgcccagacgctgccattctttcaagagagggcaagtta
aagggtgtagattattctcattgtaagggctgtggcgtgtgcgtgagtgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgagcctgccaccgcactcactcaa
tggccgcaaaaagaagaaaagaaaaaatcataa

DBGET integrated database retrieval system