KEGG   Helicobacter acinonychis: Hac_0489Help
Entry
Hac_0489          CDS       T00371                                 

Gene name
dsbC
Definition
disulfide interchange protein (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hac  Helicobacter acinonychis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(431315..431989)
Genome map
AA seq 224 aa AA seqDB search
MFSFSYFFSKKFLSVLLLISLVLSACKSNNKDKLDENLLSSGSQSSKELDDERDNIDKKS
YAGLEDIFSDTKFISPNDKYMLLVFGRNGCSYCERLKKDLKNVKELHDYVKDHFSAYYIN
ISYPKMHNFKVGDKDKNDEKEIKMSTEELAQIYAVQSTPSIVLSDKTGKTIYELPGYMPS
TQFLAVLEFIGNGEYQKAASDKDFIKQLKAYIKYKTDLSKNKSS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttttcattttcttattttttttccaaaaaatttttaagcgttttactgcttatttca
ttagttttaagcgcttgcaagtccaacaataaggacaaattagacgaaaatcttttaagt
tcaggctctcaaagctctaaagaattagacgatgagcgagacaatatagacaaaaagagt
tacgccggtttagaggatattttctcagacaccaagttcattagccccaatgataaatac
atgcttttagtttttgggcgtaatggttgctcctattgtgaaaggcttaaaaaagatctc
aagaatgtcaaggaattgcatgattatgttaaggatcattttagcgcttactatatcaat
atcagctaccctaaaatgcataattttaaagtcggcgataaagataaaaatgatgaaaaa
gaaatcaaaatgtccacagaagaattggcgcaaatttatgccgtccaatccacccctagc
attgttttatctgacaaaaccggtaaaaccatctatgaattgcccggttacatgccttct
acacaatttttagccgtgttggaatttattggcaatggagaataccaaaaagcagcaagc
gataaggatttcatcaagcaattaaaagcttacatcaaatacaaaaccgatctttctaaa
aacaagtctagctag

DBGET integrated database retrieval system