KEGG   Helicobacter acinonychis: Hac_0489Help
Entry
Hac_0489          CDS       T00371                                 

Gene name
dsbC
Definition
(GenBank) disulfide interchange protein
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hac  Helicobacter acinonychis
Brite
Enzymes [BR:hac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Hac_0489 (dsbC)
Chaperones and folding catalysts [BR:hac03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Hac_0489 (dsbC)
Secretion system [BR:hac02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Hac_0489 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 DUF836 TraF Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: CAJ99315
UniProt: Q17YG1
Position
complement(431315..431989)
Genome map
AA seq 224 aa AA seqDB search
MFSFSYFFSKKFLSVLLLISLVLSACKSNNKDKLDENLLSSGSQSSKELDDERDNIDKKS
YAGLEDIFSDTKFISPNDKYMLLVFGRNGCSYCERLKKDLKNVKELHDYVKDHFSAYYIN
ISYPKMHNFKVGDKDKNDEKEIKMSTEELAQIYAVQSTPSIVLSDKTGKTIYELPGYMPS
TQFLAVLEFIGNGEYQKAASDKDFIKQLKAYIKYKTDLSKNKSS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttttcattttcttattttttttccaaaaaatttttaagcgttttactgcttatttca
ttagttttaagcgcttgcaagtccaacaataaggacaaattagacgaaaatcttttaagt
tcaggctctcaaagctctaaagaattagacgatgagcgagacaatatagacaaaaagagt
tacgccggtttagaggatattttctcagacaccaagttcattagccccaatgataaatac
atgcttttagtttttgggcgtaatggttgctcctattgtgaaaggcttaaaaaagatctc
aagaatgtcaaggaattgcatgattatgttaaggatcattttagcgcttactatatcaat
atcagctaccctaaaatgcataattttaaagtcggcgataaagataaaaatgatgaaaaa
gaaatcaaaatgtccacagaagaattggcgcaaatttatgccgtccaatccacccctagc
attgttttatctgacaaaaccggtaaaaccatctatgaattgcccggttacatgccttct
acacaatttttagccgtgttggaatttattggcaatggagaataccaaaaagcagcaagc
gataaggatttcatcaagcaattaaaagcttacatcaaatacaaaaccgatctttctaaa
aacaagtctagctag

DBGET integrated database retrieval system