KEGG   Helicobacter acinonychis: Hac_1068Help
Entry
Hac_1068          CDS       T00371                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hac  Helicobacter acinonychis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hac_1068 (galU)
   00052 Galactose metabolism
    Hac_1068 (galU)
   00500 Starch and sucrose metabolism
    Hac_1068 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Hac_1068 (galU)
Enzymes [BR:hac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hac_1068 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(924474..925295)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLMQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKEKALQSVRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCTSHNHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIKGELLEE
GVYEIKDMVEKPSQQDAPSNLAVIGRYILTPDIFEILHETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEATNAYYKERL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgccggctatggcacacgctttttgccgatcact
aaaaccatccctaaagagatgctacccattgtggataaacctctcatgcaatacgctgtg
gaggaagcgatggaggcaggctgtgaagtgatggcgattgtgacaggaagaaacaaacgc
agtttggaagattattttgacacgagctatgaaatagagcaccagatccaaggcaccaac
aaagaaaaagcgttgcaaagcgttcgtaacattatagaaaaatgctgtttttcctatgtg
cgccagaaacaaatgaaaggtttggggcatgcgattttaaccggagaagcccttataggc
aatgaaccttttgcagtgattttagccgatgatttatgcactagccacaaccacccaagc
gtgttgaagcaaatgacttcactgtatcaaaaataccaatgctctatcgtggctattgaa
gaagtggcgttagaagaagtttcaaaatacggcgtgattaagggcgaattgttagaagag
ggggtatatgaaattaaagacatggtggaaaaaccaagccaacaagacgccccaagcaat
ttagccgtgatagggcgctatattttaaccccggatatttttgagattttgcacgagact
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttgctcactcaagccaaaaga
aaacgcatcatcgcttaccagttcaaaggcaaacgatacgattgcgggagtgtggaaggc
tatattgaagcgacaaatgcctattataaagaacgcttataa

DBGET integrated database retrieval system