KEGG   Helicobacter acinonychis: Hac_1068Help
Entry
Hac_1068          CDS       T00371                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hac  Helicobacter acinonychis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hac_1068 (galU)
   00052 Galactose metabolism
    Hac_1068 (galU)
   00500 Starch and sucrose metabolism
    Hac_1068 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Hac_1068 (galU)
Enzymes [BR:hac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hac_1068 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(924474..925295)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLMQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKEKALQSVRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCTSHNHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIKGELLEE
GVYEIKDMVEKPSQQDAPSNLAVIGRYILTPDIFEILHETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEATNAYYKERL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgccggctatggcacacgctttttgccgatcact
aaaaccatccctaaagagatgctacccattgtggataaacctctcatgcaatacgctgtg
gaggaagcgatggaggcaggctgtgaagtgatggcgattgtgacaggaagaaacaaacgc
agtttggaagattattttgacacgagctatgaaatagagcaccagatccaaggcaccaac
aaagaaaaagcgttgcaaagcgttcgtaacattatagaaaaatgctgtttttcctatgtg
cgccagaaacaaatgaaaggtttggggcatgcgattttaaccggagaagcccttataggc
aatgaaccttttgcagtgattttagccgatgatttatgcactagccacaaccacccaagc
gtgttgaagcaaatgacttcactgtatcaaaaataccaatgctctatcgtggctattgaa
gaagtggcgttagaagaagtttcaaaatacggcgtgattaagggcgaattgttagaagag
ggggtatatgaaattaaagacatggtggaaaaaccaagccaacaagacgccccaagcaat
ttagccgtgatagggcgctatattttaaccccggatatttttgagattttgcacgagact
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttgctcactcaagccaaaaga
aaacgcatcatcgcttaccagttcaaaggcaaacgatacgattgcgggagtgtggaaggc
tatattgaagcgacaaatgcctattataaagaacgcttataa

DBGET integrated database retrieval system