KEGG   Helicobacter acinonychis: Hac_1156Help
Entry
Hac_1156          CDS       T00371                                 

Gene name
acoE
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hac  Helicobacter acinonychis
Pathway
hac00010  Glycolysis / Gluconeogenesis
hac00620  Pyruvate metabolism
hac00640  Propanoate metabolism
hac00680  Methane metabolism
hac01100  Metabolic pathways
hac01110  Biosynthesis of secondary metabolites
hac01120  Microbial metabolism in diverse environments
hac01130  Biosynthesis of antibiotics
hac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hac_1156 (acoE)
   00620 Pyruvate metabolism
    Hac_1156 (acoE)
   00640 Propanoate metabolism
    Hac_1156 (acoE)
  Energy metabolism
   00680 Methane metabolism
    Hac_1156 (acoE)
Enzymes [BR:hac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hac_1156 (acoE)
Lipid biosynthesis proteins [BR:hac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hac_1156 (acoE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C ATPase_2
Motif
Other DBs
NCBI-ProteinID: CAJ99915
UniProt: Q17WR1
Position
1001939..1003927
Genome map
AA seq 662 aa AA seqDB search
MQLDDDLEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANENYENFWGELAKQKLTWFKP
FDKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDKKNKVAIIFEGEMGDYNAITYRKLHS
EVNKTANLLKNEFNIKKGDRVIIYMPMIAESVYMMLACTRIGAIHSIVFAGFSPEALRDR
INDAQAKLVITADGTFRKGKPYMLKPALDKALANNTCPSVEKTLIVIRNAKEIDYVRGRD
FVYNEMVNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWVFD
IRDNDNFWCTADIGWITGHTYVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKF
YTSPTAIRMLHAKGENEPSKYNLDSLKVLGTVGEPINPTAWKWFYEKIGNSQCSIVDTWW
QTETGGHIISPLPGATPIRASCATLPLPGIHAEVLNEDGSKTKPGEQGFLCITKPWPSMI
RNIWGDEKRYIDSYFSQIQLNGEYVYLSGDGAIVDENGYITIIGRTDDIVNVSGHRIGTA
EVESAISKHEMVVECAVVGIPDTIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILAVE
IGKIAKLDNVMYVPGLPKTRSGKIMRRILKSIVKKEPITQDLSTLEDVNVVKEIINIAQM
EE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcaattggacgatgatttagaattcgctaaaaagatctttaaccctaacagagcattt
gccaagcaagctaggattaaaaacatgtgcgaatataaggatttggtgcatgaagccaat
gaaaattatgaaaatttttggggcgaattagccaagcaaaaactcacatggtttaagccc
tttgataaggttttaaacagcgataacgcccctttttttaaatggtttgaaaatggcaaa
atcaatgtttcttataattgcatagacaggcatttaaaagacaaaaaaaataaagtggcg
atcatttttgaaggggaaatgggggattataatgctatcacttacagaaaactccactct
gaagtcaataaaacagccaaccttttaaaaaacgagttcaatatcaaaaaaggcgatagg
gtaattatctacatgcctatgattgcagagagcgtttatatgatgctcgcatgcactagg
attggggcgattcatagcatcgtttttgctgggtttagccctgaagctttgagggatagg
atcaatgacgctcaagccaaattggttatcacagcagacggaacctttagaaaaggcaaa
ccctacatgctcaaaccagcccttgacaaagctttagccaataacacctgccctagcgtg
gaaaaaacgcttattgtgatacgaaacgccaaagagattgactatgtgagagggcgcgat
tttgtctataatgaaatggtcaattaccaatccgataaatgcgaacctgaaatgatggac
tctgaagatcctttattcttactctacacaagcggatcgactgggaagcccaaaggggtc
cagcacagcagtgcggggtatttattatgggctcaaatgacaatggagtgggtttttgat
attagagataacgataatttttggtgcacggctgatattggttggatcacagggcacact
tatgtggtttatgggcctttagcttgtggggcgaccactttgatattagagggcacgatg
tcttatccggattatgggagatggtggaggatgatagaagaataccgcgtggataaattc
tacacttcccccaccgccataagaatgctgcatgcaaaaggcgaaaacgaaccctcaaaa
tacaatttggattcactcaaggttttaggaacggtgggagagcccattaaccctacagca
tggaaatggttttatgaaaaaatcggtaattcgcaatgcagtatcgtggatacctggtgg
cagacagaaacaggagggcatatcataagcccattaccgggggccacacccataagggct
agttgtgcgaccttgcccttgcctggaattcatgcggaagttttaaatgaagacggcagc
aaaaccaaaccgggagagcaagggtttttatgcatcactaagccatggccttctatgata
cgaaacatttggggcgatgaaaaacgatacattgatagctatttttctcaaatccaattg
aatggggagtatgtctatctctctggagatggcgctatcgtggatgaaaacggatacatt
accattattggacgcacagatgatattgtgaatgtgagcgggcataggattggcacggct
gaagtggagagcgctatttctaaacatgaaatggttgtagaatgtgcggtagtgggtatc
cctgataccattaaaggggagggattgtttgcgtttgtggtgctatgcgatggggctaaa
tgcaatcttggcgagagcttggaattgttaaaagaaatgaatcacatattagccgttgaa
attggaaagatcgctaaactagacaatgtcatgtatgtgccgggcttacctaaaactagg
agcggaaagattatgagaaggattttaaaatccatcgttaaaaaagagcctatcactcaa
gatttaagcacgctagaagatgtgaatgtggtcaaagaaatcataaatatcgctcaaatg
gaagagtga

DBGET integrated database retrieval system