KEGG   Helicobacter acinonychis: Hac_1479Help
Entry
Hac_1479          CDS       T00371                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hac  Helicobacter acinonychis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hac_1479 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hac_1479 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hac_1479 (thrC)
Enzymes [BR:hac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hac_1479 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1288291..1289763
Genome map
AA seq 490 aa AA seqDB search
MMQGRKMPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFEKLEWQDCLNLSYSELVE
CVFERLGLEVSKDLLTNALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQ
PLASLFSDLAVGKNEKYLMLVSTSGDTGPATLESVANMPNVFVVCLYPKDGTSLVQKLQM
VTQNASNLKVFGISGDFDDAQNTLKNLLKDDDFNEALKTRQLKLSVANSVNFGRIAFQVV
YHIWGFLELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLR
EFIETGRYDLTKRSLKQTFSPAMDILKSSNVERLLFDLFGFERTLELMQALEEEKFYELK
PKELALLQEHFSCASCLDEDCLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSSTA
SYEKFPSTTLLALNEQKKDDKTALEALKNNYNTPDSKRLDDLFEREIKHQEVLKLNEIKS
SILLWLENTH
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaggaagaaaaatgccttttgtccccacgcgctctttgaaagaaaaaaagatt
gattttattgaagcgatacttaaccctaacgcccccaaaggcgggctttacactttagaa
cattttgaaaaattagaatggcaagattgtttgaacctaagctatagtgagctggtagaa
tgcgtgtttgagcgattaggattagaagtttctaaagatttattaaccaacgctttaaaa
cgctatgaaaattttgataaccctaaaaatccagcccccatttttgcactcaatgaaagg
ctttttgtccaagagctctaccatggacctagcttagcgtttaaagacatggcgttacag
cctttagcgagcttgttttctgatctagcggtaggaaaaaatgaaaagtatttaatgctt
gtttctacaagtggggataccggtcctgcgactttagaaagtgtggcgaacatgcctaat
gtttttgtggtgtgtttataccccaaagacggcacaagtttagtccaaaaactccaaatg
gttacccaaaacgctagcaatttaaaagtgtttgggatcagtggggattttgatgatgcg
caaaacacgctcaaaaaccttttaaaagacgatgattttaacgaagccctaaaaacgcgc
caattaaaattaagcgtggctaattccgtgaattttgggcgcatcgcttttcaagttgtc
tatcatatttggggctttttagaattgtataaaaaaggtgcaatcaattctaaagaaaaa
atcaccctagccatacctagcggtaattttgggaacgcattaggggcgttttatgctaaa
aaaatgggcttaaatatcgctaaaatcaaggttgtaaccaatagcaatgatgttttaagg
gagtttatagaaacaggtcgttacgatttaaccaagcgctcattgaaacaaactttctcc
ccagctatggatattttaaaaagctccaatgtggaaagattactttttgatcttttcggg
tttgaacgcacattggaattgatgcaagctttagaagaggagaaattttatgaattaaag
cctaaagaattagcccttttacaagagcatttttcttgcgcgagctgtttagatgaagat
tgcttgaaaaccattcaagaagtttatgcagagcaccaatacttgattgacccccacacc
gccaccgctttaaacgcaagcttaaaaaccaatgaaaaaacccttgtttcttccaccgct
tcttatgaaaaattccctagcaccacccttttagccctaaacgagcaaaaaaaagacgat
aaaaccgccctagaagcgttaaaaaacaactacaataccccagatagcaaacgccttgat
gatttgtttgaaagagagatcaagcaccaagaagttttaaaactcaatgagatcaaatct
tctatccttttgtggctagaaaacacgcattaa

DBGET integrated database retrieval system