KEGG   Helicobacter acinonychis: Hac_1503Help
Entry
Hac_1503          CDS       T00371                                 

Gene name
dxr_fragment_1
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hac  Helicobacter acinonychis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hac00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1305272..1305670)
Genome map
AA seq 132 aa AA seqDB search
MVVLGSTGSVGKNALNIATKFGVKIEALSCGKNIALINEQIKIFKPKKVAILDPNDLNLL
EPLGAKVFVGLDGIDAMIEECTSHLVLNAIVGVAGLRASFKSLQRNKKLALANKESFSER
RAFIRHFTNHTR
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttagggagcaccggctctgttgggaaaaacgcccttaatatcgcaacaaaa
tttggcgtaaaaatagaagcgttaagttgcgggaagaatatcgctttaatcaatgagcaa
attaaaatattcaaacccaaaaaagtggcgattttagatcctaacgatttgaatctttta
gagcctttgggcgcgaaagtgtttgtgggactagacggcattgatgcgatgatagaagag
tgcacttctcatttagtccttaacgctattgtgggcgtggctggattgagagcgagcttt
aaaagcttacaaaggaataaaaaactagccctagcgaataaagaaagttttagtgagcgc
agggcatttattagacatttcacaaatcacacccgttga

DBGET integrated database retrieval system