KEGG   Helicobacter acinonychis: Hac_1600Help
Entry
Hac_1600          CDS       T00371                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hac  Helicobacter acinonychis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hac00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1395521..1396183
Genome map
AA seq 220 aa AA seqDB search
MWVHSQRIAPYKTLILNGLHYYPLELNVNPFNALIFTSKNAVFSLLETLKHSPKLKILQN
IPAYALSEPTAKTLQDHHFKIAFIGKKAHGKEFAKEIIPLLKGKSVLYLRAKDIASSLDT
ILLEHGINLKQAVVYENKLKHLTLSEQNALKPKENSILIFTAISHAKAFLHYFGFLKTHT
AISIGNTTAQYLQERGIQSYIAKKPSLEACLDLALSLKVD
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgtgggtgcattctcaaaggattgccccttataaaactctcattttaaatggattgcac
tactatcctttagaattaaatgtgaacccttttaacgcccttatttttacctctaaaaat
gcggtgttttccttgctagaaactttaaaacatagccctaaactcaaaattttacaaaat
atccctgcttacgctttgagtgaacccactgccaaaactttacaagatcaccattttaaa
atcgcctttatagggaaaaaagctcatggaaaagagtttgctaaagaaatcattccttta
ttgaaaggaaaaagcgttttgtatttaagggcgaaagacattgcttcttctttagacact
atccttttagagcatgggattaatcttaaacaagccgttgtttatgaaaacaaactcaaa
catttgactttaagcgaacaaaatgccctaaaacccaaagaaaatagcattcttattttt
acagccataagccatgcaaaagcctttttgcactattttggatttttaaaaactcacacc
gctatcagtatcggcaacacgactgctcaatacttgcaagagcgaggtattcaaagctat
attgctaaaaaaccttctctagaagcgtgtttggatttagctttaagtttgaaagttgat
taa

DBGET integrated database retrieval system