KEGG   Helicobacter acinonychis: Hac_1720Help
Entry
Hac_1720          CDS       T00371                                 

Definition
type III restriction-modification system (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hac  Helicobacter acinonychis
Brite
Enzymes [BR:hac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Hac_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1494176..1496500
Genome map
AA seq 774 aa AA seqDB search
MFEMATGSGKTLVMAGLILECYKKGYQNFIFFVNSASILEKTKLNFIDSVSSKYLFSENI
NINDKSVEIKSINHLNESNDSAISIYFSTIQGLFSLFTKAKENAITIEDLKDQKLVFLAD
EVHHLNTETKKKLNDTESSEKRNWESVVKLALEQNKDNLLLEFSATIPKEKSVEEKYKNL
KMITYTLKEFSKDKFCKNIYSLSYESKTLETRFLGACVSSLYKELLAQHHNIENFKPCIL
FKSERISESEDNQKRFNAFLKNLSPLDLEDFFKYSHNAFFKNAKNFFDAKNHTANLAAFL
QTKFKESTQINTNNEKELEKSMLLLNSLEDRDNPKRVIFSVDKLNEGWDVLNLFDIVRLK
NKANQKDTTKDAQLIGRGARYYPFSYNDFKPSRIEFYQRKFDLSDPLSALERLDYHAIYD
SEFIAKLKKELQTSGLGFANEKQTIPLKPTKHFKCYYASNKKIKIKNLFKDYTGPVKVKL
ESLHIPLFAFGVREKKVDFKEDKGDKTYHKTHKLDKIPINYFLKALNLKNLDFKTLKKAF
KKHAFNNKVEFIERYISQLKTNFHKNQKFDDNKILLELAVYIIENLKDTLLKEQDKPFVS
ELELKEFETHNKSLSANEFEKNPYEWLLFKDMRKLDSETERDFLIFINDHREILDKKFKE
WCILRNDHFTELKVFCNIEGPYYGQGFEPDFILFAQTHEDEFLGFTCYMEVKGEHLEHSN
AWKEEFLEMLEKATLKSHNKKLHLKGLPFFTLHNGVVKDGFVTAFNQTFKDSPC
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaatggcaaccggtagcggtaagactttagtgatggcaggtttgattttagaa
tgctataagaaaggctatcaaaactttatcttttttgtgaatagtgcaagcattttagaa
aaaaccaaattgaattttatagacagcgtctcatcaaaatacctttttagtgaaaatatc
aatatcaacgataaaagcgtagaaattaaaagcatcaatcatttaaacgagagcaatgat
agcgctatcagcatctattttagcaccattcagggcttgttttcattattcaccaaggct
aaagaaaacgctatcacaatagaggatttaaaagatcaaaaattagtttttttagcggat
gaagtgcaccatttaaacacagagaccaaaaagaaattaaatgatactgagtctagtgaa
aaacgcaattgggaaagcgtcgtgaaattagccctagaacaaaacaaagacaatttattg
ctggaatttagcgccactatccctaaagaaaaaagcgttgaagaaaaatataaaaacctg
aagatgataacttacaccttaaaagaatttagcaaggataaattttgtaaaaatatctac
tcgctctcttatgaaagtaaaacgttagaaacacgatttttaggggcatgcgtttcaagt
ttatataaagaattgttagcccaacaccacaatattgaaaactttaaaccttgtattttg
tttaaaagcgaaaggattagcgagagcgaagacaatcaaaagcgtttcaacgccttttta
aagaatctaagccctttagatttagaagattttttcaaatacagccacaacgcctttttt
aaaaacgctaaaaacttttttgatgcaaaaaaccacaccgctaaccttgccgcattctta
caaacgaaattcaaagaaagcacccagattaacaccaataatgaaaaagaattagaaaag
agcatgcttttattgaactcattagaagacagagacaaccctaaaagggtgatttttagc
gtggataaactcaatgaggggtgggatgtgctgaacttgtttgatatcgtcaggcttaaa
aataaagcaaatcaaaaagacaccaccaaagacgcccaactcatagggcgaggggctagg
tattacccctttagttacaacgattttaaaccaagccgcatagagttttaccaacgcaaa
tttgacctctccgaccccttaagcgcgctagagagattagactaccatgctatttatgac
agcgagtttatcgccaaattaaaaaaagagttacaaacttcaggtttaggatttgcaaat
gaaaaacagactatccctttaaaacccaccaaacatttcaaatgctactatgcgagcaat
aaaaagataaaaataaaaaacctatttaaagactatacaggtcctgttaaagtcaaactc
gaaagtttgcatatccccttatttgcctttggcgttcgtgaaaagaaagtggattttaaa
gaagataaaggcgataaaacttatcataagacccacaaattagataaaatccccataaac
tattttttaaaagccctgaatttaaaaaacctggattttaaaacgcttaaaaaggctttt
aaaaaacatgccttcaacaataaagtagaatttatagagcggtatatctctcaattaaaa
acaaactttcataaaaaccaaaagtttgatgacaacaaaatacttttagaactcgctgtt
tatatcattgaaaacctaaaagacacgcttttaaaagaacaagataaacccttcgtgagc
gaattagaattaaaagaatttgaaacgcataacaaaagccttagcgctaacgaatttgaa
aaaaacccttatgaatggctgctttttaaggacatgagaaagctagacagcgaaactgaa
agggattttctaatttttatcaacgaccatagagagattttagacaagaaattcaaagag
tggtgcatcttaagaaatgaccattttactgaactaaaagttttttgcaacatagaaggc
ccttattacgggcaaggctttgagcctgattttatcctttttgctcaaacgcacgaagat
gaatttttaggtttcacttgttatatggaagttaagggcgaacatttagagcattctaac
gcttggaaagaagaatttttagaaatgctagaaaaggccacgcttaaaagccacaataaa
aagctccatttaaaaggcttgccctttttcacgctccataatggcgtcgtaaaagacgga
tttgtaaccgccttcaatcaaactttcaaggactccccatgttaa

DBGET integrated database retrieval system