KEGG   Halophilic archaeon: Halar_0840Help
Entry
Halar_0840        CDS       T01603                                 

Definition
acetate/CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hah  Halophilic archaeon
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halar_0840
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halar_0840
   00620 Pyruvate metabolism
    Halar_0840
   00640 Propanoate metabolism
    Halar_0840
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Halar_0840
   00680 Methane metabolism
    Halar_0840
Enzymes [BR:hah01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Halar_0840
Lipid biosynthesis proteins [BR:hah01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Halar_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(116087..118075)
Genome map
AA seq 662 aa AA seqDB search
MTEDNVELEARLAEQDSFEPPEAFVDQANVSDPGIYDEFEENWPDCWERAAEMLDWEESY
DTVLDDSNPPFYKWFTGGSLNASAQCLDRHLAERGDETAIEWVGEPVDEADRSYTYEALH
REVNEAAAALREMGVGEDDVVTLYMPMIPELPIAMLACARIGAPHSVVFAGFSADALATR
MNAADSEYLVTCDGYYRRGDPLDHLSKANTGLNGVEHDTETLVVNRLPDADDQGVELRDD
QTYWTEALLEQESAEVEPVSRNAEDMLFLMYTSGTTGKPKGVKHTTGGYLSWATWTSHAV
LDVKPEDTYFCAADIGWITGHSYIVYGPLSLGTTTMMYEGTPDYPERNRLWEIIEEYEAD
QLYTAPTAIRAFMKWGKQYPDQHDLSSLRLLGTVGEPINPRAWKWYYTHIGDESCPIIDT
WWQTETGGQMITTLPGVGTMKPGSAGPPLPGVDAEIIDTKGEPVDAGRAGYLTIQNPWPG
MLRTLYKNDERFIGEYWAEYSDTDSDDPEDWVYFPEDGAKIDDDGYITVLGRVDDVLNVS
GHRLGTMEIESAIVGVEGVAEAAVVGGNHDIKGEAVYAYVITEDGYDENETLRDRIIQGV
EEAIGPIARPESVVFTPELPKTRSGKIMRRLLEDIANGEELGNTSTLRNPEVVESIQQRA
GD
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggataacgtagaactcgaagcgcgcctcgccgaacaggactccttcgagcca
ccggaagcgttcgtcgatcaggcgaacgtctcggatccgggcatctacgatgagttcgag
gagaactggccggactgctgggaacgcgccgccgaaatgctcgactgggaggagtcctac
gacaccgtgctcgatgactccaaccccccgttctacaagtggttcaccggcgggagcctg
aacgcctccgcacagtgtctcgaccggcatctggcggaacggggcgacgagaccgccatc
gagtgggtcggcgaacccgtcgacgaagccgaccggagctacacgtacgaagcgctccac
cgcgaagtgaacgaagcggccgcggcgctgcgcgagatgggcgttggcgaggacgacgtc
gtgacgttgtacatgccgatgattccggagctgcccattgccatgttggcgtgtgcccgc
atcggcgcgccccattcggtcgtcttcgccggcttctccgccgacgcgctcgcgacccgg
atgaacgccgccgactcggagtatctcgtcacctgtgacggctactaccgccgcggtgac
ccgcttgaccacctcagtaaggccaacacggggctcaacggtgtcgagcacgacaccgag
acgctcgtcgtgaaccggctgcccgacgcggacgaccagggtgtcgagctccgcgacgac
cagacgtactggaccgaagcgctgctggaacaggagagtgcggaggtagagccggtctct
cgtaacgccgaggatatgctgtttctgatgtacacctccggcaccaccgggaagcccaaa
ggggtgaaacacaccaccggcggctatctctcctgggcaacctggacctcccacgccgtc
ctcgacgtgaagcccgaagacacctacttctgtgcggccgacatcggctggattaccggt
cactcctacatcgtctacggcccgctctcgctcgggacgacgacgatgatgtacgaggga
acgccggactacccagaacgcaaccggctctgggagattatcgaggagtacgaggctgac
cagctctacaccgcgccgacggctatccgggcgttcatgaagtggggcaagcagtatcca
gaccagcacgacctctcgagtctcaggctgctcgggacagtcggtgagccgatcaacccc
cgcgcgtggaaatggtactacacgcatatcggtgacgaatcctgccccatcatcgacacg
tggtggcagaccgagacgggcggccagatgattaccacgctgcccggtgtcgggacgatg
aagcccggttctgcaggcccgccgctccctggcgtcgacgccgaaattatcgacaccaaa
ggcgaacctgtcgacgccggccgtgcgggctacctgacgatccagaatccatggccaggg
atgttgcggacgctctacaagaacgacgaacggttcatcggtgagtactgggcggagtac
tccgacaccgacagcgacgatcccgaggactgggtctacttcccggaggacggcgccaaa
atcgacgacgacggctacattaccgtgctgggccgggtcgacgacgtactcaacgtctcc
ggtcaccggctggggacgatggagatcgagagcgccatcgtcggcgtcgagggcgtcgcc
gaggccgccgtcgtcggcgggaaccacgacatcaaaggcgaggcggtgtacgcctacgtc
atcaccgaggacggctacgatgagaacgagaccctgcgcgaccgcatcatccagggcgtc
gaggaggccatcggtcccatcgcccggccggaatcggtcgtcttcacgcccgaactcccc
aaaacgcggtcggggaaaatcatgcgccggctgctcgaggacatcgccaacggcgaggaa
ctgggcaacacctcgacgcttcgcaaccctgaggtcgtggagtcgattcagcagcgggcg
ggcgactga

DBGET integrated database retrieval system