KEGG   Halophilic archaeon: Halar_0943Help
Entry
Halar_0943        CDS       T01603                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hah  Halophilic archaeon
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Halar_0943
   00670 One carbon pool by folate
    Halar_0943
Enzymes [BR:hah01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Halar_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
225725..226195
Genome map
AA seq 156 aa AA seqDB search
MQLVAIAAVAENCVIAADGGIPWDYPADKQFYNETIRGHPAIMGRNTFGGDPKEGATNIV
LTRSVDDVGEGAVTAHSVEEAVEAAEATGAEVAYVIGGQGVYESFLDRLERIVITRIPGS
YDGDRYFPELDDSEWKHDDEQVIGQGLRVVEYVRRD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcgttgccatcgccgccgtcgccgagaactgcgtcatcgccgccgacggcggc
atcccgtgggactacccggccgacaagcagttctacaatgaaaccatccgcggccacccc
gccataatgggccggaacacgttcggcggagaccccaaagagggcgcgaccaacatcgtg
ctgacccgctcggtcgacgatgttggtgagggagcagtcactgcccactccgtcgaggaa
gccgtggaagccgccgaagcaaccggcgccgaagtcgcctacgtcatcggtgggcaggga
gtctacgagtcgttcctcgaccgattggaacggatcgttattaccagaatcccggggagc
tacgacggcgaccgctacttccccgaactcgacgacagcgagtggaaacacgacgacgaa
caggtcatcggtcagggcctgcgcgttgtcgagtacgtccgccgggactga

DBGET integrated database retrieval system