KEGG   Halophilic archaeon: Halar_0943Help
Entry
Halar_0943        CDS       T01603                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hah  Halophilic archaeon
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hah00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hah00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
225725..226195
Genome map
AA seq 156 aa AA seqDB search
MQLVAIAAVAENCVIAADGGIPWDYPADKQFYNETIRGHPAIMGRNTFGGDPKEGATNIV
LTRSVDDVGEGAVTAHSVEEAVEAAEATGAEVAYVIGGQGVYESFLDRLERIVITRIPGS
YDGDRYFPELDDSEWKHDDEQVIGQGLRVVEYVRRD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcgttgccatcgccgccgtcgccgagaactgcgtcatcgccgccgacggcggc
atcccgtgggactacccggccgacaagcagttctacaatgaaaccatccgcggccacccc
gccataatgggccggaacacgttcggcggagaccccaaagagggcgcgaccaacatcgtg
ctgacccgctcggtcgacgatgttggtgagggagcagtcactgcccactccgtcgaggaa
gccgtggaagccgccgaagcaaccggcgccgaagtcgcctacgtcatcggtgggcaggga
gtctacgagtcgttcctcgaccgattggaacggatcgttattaccagaatcccggggagc
tacgacggcgaccgctacttccccgaactcgacgacagcgagtggaaacacgacgacgaa
caggtcatcggtcagggcctgcgcgttgtcgagtacgtccgccgggactga

DBGET integrated database retrieval system