KEGG   Halophilic archaeon DL31: Halar_0948Help
Entry
Halar_0948        CDS       T01603                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hah  Halophilic archaeon DL31
Brite
Enzymes [BR:hah01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Halar_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 MTS Methyltransf_11 PrmA Methyltransf_12 Methyltransf_23 Methyltransf_18 UPF0020
Motif
Other DBs
NCBI-ProteinID: AEN04713
UniProt: G2MKB6
Position
complement(230195..231007)
Genome map
AA seq 270 aa AA seqDB search
MDPEVLRDDMVDGLEHALGRPLSEPLGVAMRTVPRRVFVEAPYDNRPLRVDGTVALAPGT
VARLLTALDPRPDDDEEVLVVGAGVGYTAGLLAEIVGGQRVHAVDIDRGMVYRARSNLEE
AGYSEVLVDRREGSEGLPGYAPFDRILVEAGVVEPPRALLDQLADDGRLVFPKGNTEQTL
VAVTPERDAHEEYQIVDKRGPVRFAPLLVDGEQPGVIRNRTVREDREHAERSQKPGWEHE
WLDWDERLDGRERSNDAPNRGYSSWDDDRR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgaagtgctccgcgacgacatggtcgacgggctggaacacgccctcggccgg
ccgttgtcggagccgctcggcgtcgccatgcggacggtcccccgccgggtgttcgtcgag
gcgccctacgacaaccgtccgttgcgtgtcgacggcaccgtcgcactcgctcccgggacg
gtcgcacgactgctgaccgcacttgacccgcgccccgatgacgacgaggaggtgctcgtc
gtcggcgccggcgtcggctacaccgccggactcctcgctgaaattgtcggtggccagcgc
gtccacgcggtcgacatcgaccgcggaatggtctatcgcgcccgctcgaatctggaggaa
gctggctacagcgaggtactggtcgaccgccgcgagggttctgaggggctgcccgggtac
gctccgttcgatcgaattctcgtcgaggcaggcgtcgtcgagccgccgcgggcgttgctc
gaccagctcgccgacgacggccgactggtgttcccgaaaggcaacacggagcagacgctc
gtcgccgtcacgccggagagagatgcacacgaggagtaccaaatcgtcgacaagcgcggc
cccgtccggttcgcgccgctgctcgtcgatggcgaacaacccggcgtcatccgcaaccgc
accgttcgcgaagaccgcgaacacgccgagcggagccaaaaacccggctgggagcacgag
tggctcgactgggacgagcgcctcgacggtcgggaacgcagcaacgacgcgccgaatcgc
ggctactcatcctgggacgatgaccggcggtag

DBGET integrated database retrieval system