KEGG   Halophilic archaeon: Halar_1361Help
Entry
Halar_1361        CDS       T01603                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hah  Halophilic archaeon
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Halar_1361
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Halar_1361
Enzymes [BR:hah01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Halar_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(636669..637592)
Genome map
AA seq 307 aa AA seqDB search
MRQDHLISAGQLSRADVETVLDRAAEFDAALEDGDPSLRERHAGAVLALSFFEPSTRTKM
SFDAAMKRLGGRVVDMGGVDSSSVKKGESLADTVRVLEGYADGLVLRHPREGAAAMAAEF
VDIPVVNAGDGAGQHPSQTLLDLYTIRENAGLDDLTVGIVGDLKYGRTVHSLATALTEFD
ARMHFVSPESLQLPRSVRFDLHEAGAQLREHTELEPVLDQLDVLYVTRIQRERFPDEDEY
RKVAGRYRVDADSLNAAADDLTVIHPLPRVDEIAPEVDEYENAKYFEQAHNGVPVRMALL
DLLLRNE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaggaccacctcatctccgcgggacaactctcgcgggccgacgtggagacggta
ctggaccgcgcggcggagttcgacgctgccctcgaagacggcgacccaagcctccgagag
cgccacgcgggcgcggtgctcgcgctctcctttttcgagccgagcacccggacgaagatg
tcgttcgacgccgccatgaagcgcctcggcggccgggtcgtcgacatgggtggtgtggac
agctcctcggtgaagaaaggtgagagcctcgccgacaccgtgcgcgtcctcgaaggctac
gcagacggcctcgtgcttcgtcacccgcgcgagggcgcggcagcgatggcggccgagttc
gtcgatatccccgtcgtcaacgcaggcgacggcgcgggccagcacccctcccagacgctg
ctcgacctctacaccatccgcgagaacgccggcctcgacgatctcaccgtgggtattgtg
ggcgacctgaaatacggccggacggtccactcgctggcgaccgcgctgacggagttcgac
gcccggatgcacttcgtcagcccggagtcgctccaacttcctcgctcggttcggttcgac
ctgcacgaagcaggcgctcagctccgagagcacacggagttggaaccagttctcgaccag
ttggacgtcctctacgtcacccgtatccagcgcgagcggttccctgacgaggacgaatac
cgcaaggttgcgggccgctaccgtgttgacgccgacagcctcaacgccgccgccgacgac
ctgactgtgatacacccgctcccgcgcgtcgacgaaatcgcgcccgaagtcgacgagtac
gagaacgcgaaatacttcgaacaggcccacaacggcgtccccgttcggatggcactgctc
gacctcctccttcgcaatgagtga

DBGET integrated database retrieval system