KEGG   Halophilic archaeon: Halar_1529Help
Entry
Halar_1529        CDS       T01603                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
hah  Halophilic archaeon
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:hah00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
796583..798571
Genome map
AA seq 662 aa AA seqDB search
MSSEPTETDEQQDPLAEHEQQLNDLLLDVEGPDAPDAESHLSGLGLDVSRRGLMKAGAAA
GAIGAFAGCAGLQGGGANTEAKGGSGDVPDHMVPPGEHDEYYGFWSGGHSGEIRVMGLPS
MRELTRIPVFNPEPAKGYGFDNETSEMLDDAGGYTWGDSHHPNLSETGGEYDGRYIFVND
KANGRVARVNLKYFETDAIVDIPNVQSVHGCCIQSPDTEYVFANGEFRTPLPNDGRDVNN
PEEYVSLFSAIDPETMDVRWQVKVDGNLDIVDSDKDGRWVLSSAYNDEEGVEIEEMTKDD
RDSVKAFDVPAIQELVDAGEGTEVDGIPVIDGTESSKHNSGDDPIVRYIPTPKSPHCVEV
TPDGKYGMVAGKLSPTVSIIDIEKLESASDPADTIIGQPKVGLGPLHTTYDGRGNAYTSL
FIDSQVVKWDIEAAVNAEKGSEEPILGKIDVHYNPGHIQAVQAMSSEPTGDWLVVLNKLS
KDRFLPVGPIYPDNDQLVYIGNDKDNDAGGMELVSDHPVYPEPHDAVFAQKDKLDPATTW
EPEDYEGEKEYISEDASTVERIDDSTVEVKTSVKRSEFGLRDFTVQEGDEVRLTATNIEG
SKDIVHGMAIPEHNVNLALAPKDTREVTFTADKPGVYWIYCTYFCSALHLEMRSRMIVEP
ED
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagaaccaacagaaactgacgagcagcaagacccgctcgctgaacacgaacag
caactgaacgacctgctgctggatgtcgaaggcccggacgcccctgacgccgagagtcac
ctctcgggattggggcttgacgtcagccgccggggcttgatgaaggctggcgccgccgca
ggcgccattggagcgttcgctggctgtgccggcctgcagggcggtggggcaaacaccgag
gccaagggcggcagtggtgacgtgccagaccacatggtcccgccgggtgaacacgacgag
tactacggcttctggtccggtggccactccggcgagattcgggtgatggggctcccctcg
atgcgggaactcacccggattccggtgttcaaccctgagcctgcgaaaggctacggcttc
gacaacgagaccagcgagatgctggacgacgccggcggctacacgtggggtgactcccac
cacccgaacctttcggagaccggcggtgagtacgacggccggtacatcttcgtcaacgac
aaggccaacggccgagtggctcgggtgaatctgaaatacttcgaaaccgacgccatcgtc
gacattccgaacgtccagtccgtccacggctgctgtatccagagcccggacacggagtac
gtgttcgccaacggtgagttccggacgccgctgcccaacgacggccgggacgtcaacaac
cctgaggagtacgtctccctgttcagtgccattgacccggagaccatggacgtgcgctgg
caggtgaaagtcgacggcaacctcgacatcgttgactccgacaaggacggtcgctgggtg
ctctcctcggcatacaatgacgaggagggtgtcgagattgaagagatgaccaaggacgac
cgggactccgtcaaagcgttcgacgtcccggccatccaggaactagtcgacgccggcgaa
ggcaccgaagtcgacggaatcccagtcatcgacggcaccgagtcgagcaaacacaacagc
ggcgacgacccgattgttcggtacatcccgacgccgaagtcgccccactgtgtcgaagtc
acgcccgatggaaagtacggaatggtcgctgggaaactctccccgaccgtctccatcatc
gatatcgagaagctggagtcggcatccgaccctgccgacaccatcatcggccagcctaaa
gtcgggctgggaccgctgcatacgacctacgacggccgcgggaacgcctacacctcgctg
ttcatcgactcgcaggtggtcaagtgggatatcgaggcggcggtcaacgccgagaagggc
tccgaagagccgattctcgggaagatcgacgtccactacaaccccggccacatccaggct
gtccaggccatgtcctcggagccgaccggtgactggctggtcgtactgaacaagctctcg
aaagaccggttcctcccggtcgggccgatctacccggacaacgaccaactggtctacatc
ggcaacgacaaagacaacgacgccggcgggatggagctggtctcggaccacccagtctac
cccgaaccgcacgacgcggtgttcgcccagaaagacaaactcgaccccgcgaccacctgg
gagccagaggactacgagggcgagaaagagtacatctcggaggatgcctcgaccgtcgag
cgtatcgacgacagcaccgtcgaggtcaaaacctccgtcaaacggagcgagttcggcctt
cgtgacttcacggttcaggagggcgacgaggtccgcctcactgcgaccaacatcgagggg
agcaaggacatcgtccacgggatggccatccccgagcacaacgtgaacctcgcgctcgcg
cccaaggacacgcgcgaggtcaccttcacggcggacaagcccggtgtgtactggatctat
tgcacgtacttctgcagtgccctgcaccttgagatgcgctcacgaatgatcgtcgaacca
gaggactaa

DBGET integrated database retrieval system