KEGG   Halophilic archaeon DL31: Halar_1771Help
Entry
Halar_1771        CDS       T01603                                 

Definition
(GenBank) F420-0:gamma-glutamyl ligase
  KO
K12234  coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
hah  Halophilic archaeon DL31
Pathway
hah00680  Methane metabolism
hah01120  Microbial metabolism in diverse environments
Module
hah_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Halar_1771
Enzymes [BR:hah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Halar_1771
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Halar_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_ligase
Motif
Other DBs
NCBI-ProteinID: AEN05487
UniProt: G2MK65
Position
1035398..1036156
Genome map
AA seq 252 aa AA seqDB search
MELFAVPDLPEIREGDDLAAMVAEQVDLRPDDVVCVASTVVSKSEGRTADLADFPAGPRA
KEIARSLEDISGDEKDPRFAQAVLEESTEVVMDKPFILTETHCGHVGVNAGIDRSNVPDH
DLLLLPKRPSQSAERIHEGLPESSPVVVTDTSGRPFRHGQRGMAIGWAGMPASRDWRGET
DRDGHELQVTVQSVIDELAGAANLVSGEGDGGEPIVVVRDWEFGDHEGSNNLFREMHGDF
VRQALRGWEYEG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggagctgttcgccgtccccgacctgcccgaaatccgcgagggtgacgacctcgcggcg
atggtcgccgaacaggtcgacctccggcccgacgacgtggtctgtgtcgcctcgacggtc
gtctcgaagagcgagggccggaccgccgacctcgccgacttccccgcaggcccacgagcg
aaagagattgcgcggagcctcgaggatatttccggcgacgagaaggacccgcgcttcgcc
caggccgtcctggaagagagcaccgaggtggtgatggacaagccgttcattctgaccgag
acacactgcggacacgtgggtgtcaacgcggggattgaccgctcaaacgtgccggaccac
gacctgctcctcctcccgaaacggccgagccagtccgccgagcgcatccacgaaggcctt
cccgaatcctcacctgtcgtcgtcaccgacacctcgggccggccgttccggcacggccag
cgcgggatggcgatcggctgggccgggatgcccgcctcacgcgactggcgcggcgagacc
gaccgggacggccacgaactgcaggtgactgtccagagcgtcatcgacgaactcgcaggc
gctgccaacctcgtctccggcgagggcgacggcggcgaaccgattgtggtcgttcgggac
tgggagttcggcgaccacgaggggagcaacaatctcttccgggagatgcacggggatttc
gtccggcaggcgctacgcggctgggagtacgagggataa

DBGET integrated database retrieval system