KEGG   Halophilic archaeon: Halar_1771Help
Entry
Halar_1771        CDS       T01603                                 

Definition
F420-0:gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
hah  Halophilic archaeon
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:hah00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1035398..1036156
Genome map
AA seq 252 aa AA seqDB search
MELFAVPDLPEIREGDDLAAMVAEQVDLRPDDVVCVASTVVSKSEGRTADLADFPAGPRA
KEIARSLEDISGDEKDPRFAQAVLEESTEVVMDKPFILTETHCGHVGVNAGIDRSNVPDH
DLLLLPKRPSQSAERIHEGLPESSPVVVTDTSGRPFRHGQRGMAIGWAGMPASRDWRGET
DRDGHELQVTVQSVIDELAGAANLVSGEGDGGEPIVVVRDWEFGDHEGSNNLFREMHGDF
VRQALRGWEYEG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggagctgttcgccgtccccgacctgcccgaaatccgcgagggtgacgacctcgcggcg
atggtcgccgaacaggtcgacctccggcccgacgacgtggtctgtgtcgcctcgacggtc
gtctcgaagagcgagggccggaccgccgacctcgccgacttccccgcaggcccacgagcg
aaagagattgcgcggagcctcgaggatatttccggcgacgagaaggacccgcgcttcgcc
caggccgtcctggaagagagcaccgaggtggtgatggacaagccgttcattctgaccgag
acacactgcggacacgtgggtgtcaacgcggggattgaccgctcaaacgtgccggaccac
gacctgctcctcctcccgaaacggccgagccagtccgccgagcgcatccacgaaggcctt
cccgaatcctcacctgtcgtcgtcaccgacacctcgggccggccgttccggcacggccag
cgcgggatggcgatcggctgggccgggatgcccgcctcacgcgactggcgcggcgagacc
gaccgggacggccacgaactgcaggtgactgtccagagcgtcatcgacgaactcgcaggc
gctgccaacctcgtctccggcgagggcgacggcggcgaaccgattgtggtcgttcgggac
tgggagttcggcgaccacgaggggagcaacaatctcttccgggagatgcacggggatttc
gtccggcaggcgctacgcggctgggagtacgagggataa

DBGET integrated database retrieval system