KEGG   Halophilic archaeon: Halar_1934Help
Entry
Halar_1934        CDS       T01603                                 

Definition
succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hah  Halophilic archaeon
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halar_1934
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halar_1934
   00650 Butanoate metabolism
    Halar_1934
  Energy metabolism
   00190 Oxidative phosphorylation
    Halar_1934
   00720 Carbon fixation pathways in prokaryotes
    Halar_1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1194149..1194517)
Genome map
AA seq 122 aa AA seqDB search
MADHYSSFDRSGTSWLLQRLTAAFLVVVLAFHFFLLHFVNHAADVTFAGTSARMSTWTYF
SLMVLFLLTATFHGVNGVYNTVVGQDGVTGWKKTAVTAVLVVASLLMVVQGLRTALVWTN
LF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccactactcatccttcgaccgctcgggcacgagctggctgctgcagcgcttg
acagcggcgttcctcgtcgtggtgctggcgttccacttcttcctcctgcacttcgtcaac
cacgctgccgacgtgacgttcgcggggacctccgcccggatgagcacctggacgtatttc
tcgctgatggtgctgttcctgctgacggcgacgttccacggcgtcaacggcgtctacaac
accgtcgtgggccaggacggcgtcacgggatggaagaagaccgcggtgacggctgtgctg
gtcgtcgcgagcctcctgatggtcgtacaggggcttcgaaccgcactcgtctggaccaac
ctcttctaa

DBGET integrated database retrieval system