KEGG   Halophilic archaeon DL31: Halar_1934Help
Entry
Halar_1934        CDS       T01603                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hah  Halophilic archaeon DL31
Pathway
hah00020  Citrate cycle (TCA cycle)
hah00190  Oxidative phosphorylation
hah00650  Butanoate metabolism
hah00720  Carbon fixation pathways in prokaryotes
hah01100  Metabolic pathways
hah01110  Biosynthesis of secondary metabolites
hah01120  Microbial metabolism in diverse environments
hah01130  Biosynthesis of antibiotics
hah01200  Carbon metabolism
Module
hah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hah_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halar_1934
   00650 Butanoate metabolism
    Halar_1934
  Energy metabolism
   00190 Oxidative phosphorylation
    Halar_1934
   00720 Carbon fixation pathways in prokaryotes
    Halar_1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt UPF0182
Motif
Other DBs
NCBI-ProteinID: AEN05640
UniProt: G2MLN7
Position
complement(1194149..1194517)
Genome map
AA seq 122 aa AA seqDB search
MADHYSSFDRSGTSWLLQRLTAAFLVVVLAFHFFLLHFVNHAADVTFAGTSARMSTWTYF
SLMVLFLLTATFHGVNGVYNTVVGQDGVTGWKKTAVTAVLVVASLLMVVQGLRTALVWTN
LF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccactactcatccttcgaccgctcgggcacgagctggctgctgcagcgcttg
acagcggcgttcctcgtcgtggtgctggcgttccacttcttcctcctgcacttcgtcaac
cacgctgccgacgtgacgttcgcggggacctccgcccggatgagcacctggacgtatttc
tcgctgatggtgctgttcctgctgacggcgacgttccacggcgtcaacggcgtctacaac
accgtcgtgggccaggacggcgtcacgggatggaagaagaccgcggtgacggctgtgctg
gtcgtcgcgagcctcctgatggtcgtacaggggcttcgaaccgcactcgtctggaccaac
ctcttctaa

DBGET integrated database retrieval system