KEGG   Halophilic archaeon DL31: Halar_2079Help
Entry
Halar_2079        CDS       T01603                                 

Definition
(GenBank) Agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
hah  Halophilic archaeon DL31
Pathway
hah00330  Arginine and proline metabolism
hah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Halar_2079
Enzymes [BR:hah01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Halar_2079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEN05763
UniProt: G2MLT6
Position
complement(1321157..1322002)
Genome map
AA seq 281 aa AA seqDB search
MGFPGAVADREHADYVLVGAPLDISTTFQPGTRFGPDRIRRFTQTYDDYDHRTGLFFSDL
RVHDAADCRAWDDAPDYLDYLGGTLVDAVRDGAVPLTLGGEHTVTAAGVRATDPDVLVTL
DAHLDLRDEYDGNPWSHASVCRRALDGDPEGAALGSVDGTADRLVVLGGRTGSPEEWERA
EEADVTVVPPEDVAAWEPDFEGEDVYLSIDIDGADPSVAPGTGTMEPFGLSSREMRDVVR
AVAPHAVGCDAVEVNDRDDGQAAALAGKLVKEFVYSHADSN
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggggttccccggcgccgtcgccgaccgcgagcacgccgactacgtcctggtcggcgcc
ccgctcgacatctcgacgacgttccagccgggaacccgattcgggccggaccgcatccgg
cggttcacccagacgtacgacgactacgaccaccgaacaggcctgttcttctcggacctg
agggtccacgacgcggctgactgccgcgcgtgggacgacgccccggactatctcgactat
ctcggcggcaccctcgtagacgccgtccgcgacggcgctgtccctctcacactgggtggc
gagcacactgtcaccgccgcgggcgttcgcgcgacggaccccgacgtgttggtcacgctc
gacgcccatctggacctccgagacgagtacgacggcaatccgtggagccacgcctcggtc
tgtcgtcgcgcgctcgacggcgaccccgagggcgctgcactggggagcgtcgacggcacc
gccgacaggctggtggtgctcggcggccgaaccggctcgccggaggagtgggagcgcgcc
gaagaagctgacgtgacagtggtcccccccgaagacgtggctgcgtgggagcccgatttc
gagggcgaagatgtgtacctctccatcgatatcgacggggcggacccgtcggttgcgccc
gggaccggaacgatggagccctttgggctctcctcccgggagatgcgggatgtggttcga
gccgtggcccctcatgcggttgggtgtgatgcggttgaggtgaacgaccgcgacgacggg
caggcggcggcgctggcggggaagttggtgaaggagttcgtctactcgcatgctgattcg
aattag

DBGET integrated database retrieval system