KEGG   Halophilic archaeon: Halar_2079Help
Entry
Halar_2079        CDS       T01603                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hah  Halophilic archaeon
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hah00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1321157..1322002)
Genome map
AA seq 281 aa AA seqDB search
MGFPGAVADREHADYVLVGAPLDISTTFQPGTRFGPDRIRRFTQTYDDYDHRTGLFFSDL
RVHDAADCRAWDDAPDYLDYLGGTLVDAVRDGAVPLTLGGEHTVTAAGVRATDPDVLVTL
DAHLDLRDEYDGNPWSHASVCRRALDGDPEGAALGSVDGTADRLVVLGGRTGSPEEWERA
EEADVTVVPPEDVAAWEPDFEGEDVYLSIDIDGADPSVAPGTGTMEPFGLSSREMRDVVR
AVAPHAVGCDAVEVNDRDDGQAAALAGKLVKEFVYSHADSN
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggggttccccggcgccgtcgccgaccgcgagcacgccgactacgtcctggtcggcgcc
ccgctcgacatctcgacgacgttccagccgggaacccgattcgggccggaccgcatccgg
cggttcacccagacgtacgacgactacgaccaccgaacaggcctgttcttctcggacctg
agggtccacgacgcggctgactgccgcgcgtgggacgacgccccggactatctcgactat
ctcggcggcaccctcgtagacgccgtccgcgacggcgctgtccctctcacactgggtggc
gagcacactgtcaccgccgcgggcgttcgcgcgacggaccccgacgtgttggtcacgctc
gacgcccatctggacctccgagacgagtacgacggcaatccgtggagccacgcctcggtc
tgtcgtcgcgcgctcgacggcgaccccgagggcgctgcactggggagcgtcgacggcacc
gccgacaggctggtggtgctcggcggccgaaccggctcgccggaggagtgggagcgcgcc
gaagaagctgacgtgacagtggtcccccccgaagacgtggctgcgtgggagcccgatttc
gagggcgaagatgtgtacctctccatcgatatcgacggggcggacccgtcggttgcgccc
gggaccggaacgatggagccctttgggctctcctcccgggagatgcgggatgtggttcga
gccgtggcccctcatgcggttgggtgtgatgcggttgaggtgaacgaccgcgacgacggg
caggcggcggcgctggcggggaagttggtgaaggagttcgtctactcgcatgctgattcg
aattag

DBGET integrated database retrieval system