KEGG   Halophilic archaeon: Halar_2154Help
Entry
Halar_2154        CDS       T01603                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hah  Halophilic archaeon
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halar_2154
  Amino acid metabolism
   00300 Lysine biosynthesis
    Halar_2154
Enzymes [BR:hah01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Halar_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1397656..1399044)
Genome map
AA seq 462 aa AA seqDB search
MASVTREEIDAAVEARRDEIVAFLSEFVAIDTENPPGRNYREGAEFLGAALDERGYDVEY
VEVPESVVAEHYPSRSDRERVNVIGRKGSLDGVDVDGSDAPVRQPGTQGVPGDAADPEAA
GAAAGPHVHFTGHFDVVPAGEDWTRDPFDATVEGEGNEAKLYGRGASDMKSGIVASLFAG
DALEAAGVDFSTTTGSLSQSMTVDEETGGFTGLGYLVSEGHVSQSNTDYCVYTECFDGSR
VCLGHRGVLKFRVVASGAKAHGCMAQDGVNAASALTDFLGRVEEYREELHDRTTDEPVTP
ESSRRADISTTMLDAGYSENVVPDRATATFYRVLVPEEGVEGARTEIRELMAATEERFPA
STLEYEEIMFAEPAIVSADCRVSQVYTEEITRQLGESDFVVSPGSDDQRFVVNDAGIDEC
IVYGPGPLDQAHVADEYVPIERLVTATKVMAASTAELLGVLE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggtcacccgggaggaaatcgacgcggctgtcgaggcaaggcgggacgaaatc
gtcgcgttcctcagtgagttcgtcgctatcgacacggagaatccaccggggcggaactac
cgcgagggcgcggagttcctcggcgctgcgctggatgagcggggctacgacgtggagtac
gtcgaggtaccggaatccgtggtcgcggagcattacccgagccgcagcgaccgcgagcgc
gtgaacgtcatcgggcggaaagggagcctcgatggtgtcgacgttgacgggagcgacgct
cccgttcgccagccggggacgcagggcgtccccggcgacgctgcagacccagaggccgct
ggggcggcagcgggcccacacgtccacttcacgggccatttcgacgttgttccggccggc
gaggactggacccgcgacccgttcgacgcaacggttgaaggggagggaaacgaggcgaag
ctctacggccgcggcgccagcgacatgaagtctgggatcgtcgccagtctgttcgcgggt
gacgcactggaggccgcgggggtggatttctccactaccacgggctcgctctcccagagc
atgactgtcgacgaggagacgggcggcttcaccggccttggctacctcgtctcggagggc
cacgtctcgcagtcgaacacggactactgcgtctacacggagtgtttcgacggctcccgg
gtctgtcttggccaccgcggcgtcctgaagttccgcgtcgtcgccagcggggcgaaggcc
cacggctgcatggcccaggacggcgtcaacgccgcctctgcgctcacggatttcttgggc
cgggttgaagagtaccgcgaggaactccacgaccgcaccactgacgagccagtcaccccc
gaatcttcccgccgggcggacatctccacgacgatgctggacgccggctactcagagaac
gtggtgcccgaccgcgcgacggcgacgttctaccgcgtgttggtgcccgaggagggagtg
gagggtgctcgcacagagattcgggagctgatggccgcgacggaggagcggttccccgcc
tcaacgctcgagtacgaggagataatgttcgccgagccggccatcgtttctgcggactgc
cgggtcagtcaggtgtacacggaggagatcaccagacagctcggagaatcggatttcgtc
gtctcaccgggctcagacgaccagcgattcgtggtcaacgacgccggcatcgacgagtgc
atcgtctacggccccgggccgctcgaccaggctcacgtcgccgacgagtacgtcccaatc
gagcggctggtgacggcaacgaaggtgatggcggcgtcgacggcggaactgctgggcgtg
ctggagtag

DBGET integrated database retrieval system