KEGG   Halophilic archaeon: Halar_2168Help
Entry
Halar_2168        CDS       T01603                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hah  Halophilic archaeon
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Halar_2168
Enzymes [BR:hah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Halar_2168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1413013..1413897
Genome map
AA seq 294 aa AA seqDB search
MTVLCAGHVNWDVTLRVDHLPEPDGEVAVEERVQRGGGSAANVAAGLAGLDTPAALFGSV
GDDESGTKAIEELETAGVETDRIRAVPGAETAVKYLVVDHEGEVMVLSNAGANESFTAEH
LTGGFDGIDHLHLTSQLPETAAELAEHAHEAGVSVSFDPGRRLGDRSYAETLRHVDLLFL
NAKEAVAMIESELDDALPQAASVVIKLGEEGAELRGPTVVRHGGFAVDPLDTTGAGDAFA
AGFLAEVEEAGGLDAVDTEDALGTANACGAVAAMETGARVKLSWARLQQFEQRH
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctctgtgcgggccacgtcaactgggacgtgaccctccgggtcgaccacctc
cctgaacctgatggcgaggttgccgtcgaagagcgcgtccagcgcggcggcggctcggcg
gccaacgtcgccgcgggcctcgccggcctcgacacgcccgcggcgctgttcggtagcgtc
ggcgacgacgaatcggggacgaaagccatcgaggaactggagaccgccggggtcgagacc
gaccgcattcgggcggttccgggcgccgagacggcggtgaagtatctggtcgtcgatcac
gagggcgaggtgatggtgctctcaaacgccggcgccaatgagtcgttcaccgctgaacac
ctcactggtggattcgacggtatcgaccacctccatctcaccagccagctgcccgagaca
gccgccgagcttgctgagcacgcccacgaagccggcgtgtcggtcagtttcgaccccggc
cgccgtctcggcgaccgcagctacgccgagacgctccggcacgttgatctgctctttctc
aacgcgaaggaggccgtcgccatgatcgaaagcgagttggacgacgcgctcccgcaggcg
gcgtcggtcgtcatcaaactcggcgaggagggtgcggaactccgcggcccgacggtggtc
cggcacggtgggtttgcagtggacccactcgacacgactggcgcgggcgacgccttcgcc
gcgggcttcctcgcggaggtcgaggaagcgggtggcctcgacgccgtcgatactgaagac
gcactcgggacggcgaacgcctgcggtgcggtcgcggcgatggaaaccggggcacgagtg
aagctctcgtgggcgcgtctgcagcagttcgaacagcgccactga

DBGET integrated database retrieval system