KEGG   Halophilic archaeon DL31: Halar_2192Help
Entry
Halar_2192        CDS       T01603                                 

Definition
(GenBank) Cellulase
Organism
hah  Halophilic archaeon DL31
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1431209..1432276)
Genome map
AA seq 355 aa AA seqDB search
MQTPQREFLDALLTTPSPSGFETRGQRVWVDYVSQFADRVETDAYGNAVAIHEGDPDEDT
EFAVGGHADEIGFIVRDITDEGFLRIARVGGSDRTVSKGQHVTVHTDEGPVQGVIGQTAI
HLREQGKEEYEEIAEQFVDIGATDDEDAKELVTIGDPATFSSGIQELKGSRVAARGMDNR
TGTWVAAETLRRASEAGAAATVVAVSTVQEEVGLKGAQMVGYDLDPDAFIAVDVTHATDN
PDVAGKNRGPVKLSEGPVVGRGSANHPALVDLAREAADADDVDHQFQAAGSGTGTDADGV
FTERGGIPSLNVSIPNRYMHTPVEVVDLEDLDAVADLCVGMAERAAEDAPFGVDI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaccccaacgggagttcctcgacgcgctgctgactaccccgagcccctcgggc
ttcgagacccgcggccagcgcgtctgggtcgactacgtctcgcagtttgccgaccgggtc
gagacagacgcctacggcaacgccgtcgcgattcatgagggcgacccggacgaagacacg
gagttcgccgtcggcggccacgccgacgaaatcggcttcatcgtccgcgatatcaccgac
gagggcttcctccgcatcgcccgcgtgggtggctctgaccggacggtctcgaagggccaa
cacgtcacggttcacaccgacgaggggcccgtgcagggcgtcatcggccagacagcgatc
cacctgcgagagcagggcaaggaggagtacgaggaaatcgccgagcagttcgtcgacatc
ggggcgacggacgacgaggacgccaaggaactggtcacgattggggacccagccacgttc
tcctctgggattcaggaactcaaagggagccgcgtcgcggcccgcggcatggacaaccgc
acgggaacgtgggtcgccgcggagacgcttcgccgggcctccgaggccggcgcggctgcg
acggtcgtcgccgtctcgacagtgcaggaggaagtcggtctcaaaggggcgcagatggtc
ggctatgacctcgacccggacgccttcattgccgtcgacgtgactcacgccaccgacaac
cccgacgtggctgggaagaaccgtggccccgtaaaactcagcgaggggccggtggttggc
cgcgggagcgcgaaccaccccgcgcttgtcgacctggcgcgtgaggctgccgatgcggac
gacgtggaccaccagttccaggccgccgggagcggcaccgggactgatgcagacggcgtg
ttcacggaacgtggcgggattccctcactgaacgtgagcatcccgaatcgctacatgcac
acgccggtggaggttgtggatctggaggatttggacgccgttgcagacctctgtgtgggg
atggcggagcgtgcggccgaagatgcgccgtttggcgtggatatctga

DBGET integrated database retrieval system