KEGG   Halophilic archaeon: Halar_2595Help
Entry
Halar_2595        CDS       T01603                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hah  Halophilic archaeon
Brite
Enzymes [BR:hah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Halar_2595
Transfer RNA biogenesis [BR:hah03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Halar_2595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1800079..1801740
Genome map
AA seq 553 aa AA seqDB search
MSTDAAESDPPAFVDACEELCRRIIEEDLERDDLEAAKREVCGTLGAPKVPTNGDILSYA
PDGWREDVKEVVRRKPVRTASGVSPIAIMTSPHLCPHGKCLYCPGGPASDFSSAQSYTGH
EPAAARGEQNDYDPYGQVTLRLEQLRAIGHPVDKAELILMGGTMTARSHDYQEWFVKRAL
QAMNEYDLDSNPEPSQTQSFAEPPEKHEFEYLEDVISRNETGDIRVTGITFETKPDWCDP
EQITRMLDLGGTKVEVGVQTTYERINREMHRGHGTQASIDANRRLRDAAFKVGFHMMPGQ
PGMSQEMCREDFRQLFDSPDWRPDYLKIYPTLVVKGTRVYDMWKREDFDPLDNETAADVV
ADAMNEIPKYCRLQRVQRDIPADFIEGGVWKSNLRQLAQQRAEEKGYTIRDIRAREVGHN
EADPDPAEIQLDVMEYEAGGGTEYFISFEDPVRDLLVGFCRLRFPNDPVRRELEGAALVR
ELHVYGSPATFDGTDEGDWQHRGYGQRLVEKAEQLAAAGGYGKLSIISGIGVREYYREKL
GYHQDGPYVSKLL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggacgctgccgagtccgacccgcccgccttcgtcgacgcctgcgaggagctc
tgccgccgcatcatcgaggaagacctcgaacgcgacgacctggaggccgcaaagcgagag
gtctgtggcaccctcggggcgcccaaagtcccgacgaacggcgatatcctctcctacgcc
ccggacggctggcgtgaggacgtgaaggaagtggtccgccgcaagcccgttcgcaccgcg
tcgggcgtctcacccatcgccatcatgacgtcgccgcacctctgcccacacgggaagtgt
ctctactgtcctggaggcccggcctcggatttctcctctgcgcagtcttacaccggtcac
gaacccgcggccgcccgcggcgagcagaacgactacgacccctacgggcaggtcacgctc
cgcctcgaacagctccgggctatcggccaccccgtcgacaaagcagaactcatcctgatg
ggcggcaccatgaccgcacgcagccacgactaccaggagtggttcgtcaagcgagcgctg
caggcgatgaacgagtacgatctcgattccaaccccgagccgagtcagacccagagcttt
gccgagccacccgagaaacacgagttcgaatatctcgaggacgtcatttcccgaaacgag
actggcgatatccgggtgactggcatcaccttcgagaccaagcccgactggtgtgacccc
gagcagataacccggatgctggacctcggcggcaccaaagtcgaggttggcgtccagacc
acctacgaacgcatcaaccgggagatgcaccgcggccacggcacccaagcgagcatcgac
gcgaaccgccgcctgcgcgacgccgcgttcaaagtcggcttccacatgatgcccgggcaa
cccggcatgagccaagaaatgtgccgcgaggacttccggcaactgttcgactcacccgac
tggcgaccggactacctcaaaatctacccgaccctcgtcgtgaaaggcacccgcgtctac
gacatgtggaagcgcgaggatttcgaccccctcgacaacgagacggccgcggacgtcgtc
gccgacgcgatgaacgagattccgaagtactgccggctccagcgcgtccaacgggacatc
cccgccgacttcatcgaaggcggcgtgtggaagtcgaatctccgccaactggcccagcag
cgggccgaggagaaaggctacacgattcgggatattcgcgcacgagaagtcgggcacaac
gaggcggaccccgaccctgcagagattcagttggatgtgatggagtacgaggccggcggc
gggacggagtacttcatctccttcgaggacccagttcgggacctgctcgtcgggttctgc
cggctccggttccccaacgaccccgtgcgccgtgaactggaaggggccgccctcgtccgg
gagcttcacgtctacggctcgccggcgacgttcgacggcaccgacgaaggtgactggcag
caccgtggctacggccagcggttggtcgaaaaggccgagcaactggccgccgcaggcggc
tacggtaagctgagcatcatctcagggatcggtgtccgggagtactaccgtgagaaactg
ggctatcaccaggacggcccgtacgtctcgaagttgctctaa

DBGET integrated database retrieval system