KEGG   Halophilic archaeon: Halar_2632Help
Entry
Halar_2632        CDS       T01603                                 

Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hah  Halophilic archaeon
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halar_2632
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halar_2632
   00620 Pyruvate metabolism
    Halar_2632
   00640 Propanoate metabolism
    Halar_2632
  Energy metabolism
   00680 Methane metabolism
    Halar_2632
Enzymes [BR:hah01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Halar_2632
Lipid biosynthesis proteins [BR:hah01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Halar_2632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1840207..1842258)
Genome map
AA seq 683 aa AA seqDB search
MDASEFEVAHEPSQAFVESTNVWEFMQTYDIDDYDELIERTTSEVPGEPDSGVDWFWDEL
VDYLDIDFYEGYDEVRDDTHGPQFTDWYPGGKINIAHNTLDRHAALENGDRNKVACIWEG
EDGVVRERTFHELHRQANRVANYLESVGIETGDTVALYMPMVPEVISILYGCFKVGAIAV
PIFSGFGVEATATRIDDAEPSVLFTGDGFYRRGSAISLKGTADDAIEEAGHVEHTVVYDR
IGTEARSASNGAGGEATRGDTESDEVDVPWSDERDEWWGEVVESQESEYETKSLPADQES
MLLYSSGTTGEPKGIVHTHAGVLAQCAKEIHFGFDQKPGDRFFWVSDIGWMMGPWTLIGN
HHFGGTTFMYEGAPDYPNPGRFWEMIERHRITTFGVSPTAIRALRKHGDEVVKQYDLSSL
RLLGSTGEPWDPESWQWYYEEIGNEECPIINISGGTEICGCFLMPMPINDLKPGTLGGPG
LGMDIDIVDSAGNSVTEKHERGYLVARDSCPSMTKSLWSGDERYLEEYWSTWEDLWDHGD
FAQKDEDGFWFLHGRADDALNVAGRKVGPAEIEGVLAEHDSVNQAAAVGVDDETTGTAVV
AYVVLESGLDPSDELREELRTLVGQEHGKPFRPREIRFVSEFPKTQSGKVIRRAIAAVHQ
GKDPGDLSSMENPSALEEIRNAR
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgagcgagttcgaggtcgcccacgaacccagtcaggcgttcgtggagtcgacc
aacgtctgggagttcatgcagacgtacgacatcgacgactacgacgaactgatcgaacgc
acaaccagcgaggttccgggggaacccgactcgggcgtcgattggttctgggacgaactc
gtcgactacctcgatatcgacttctacgagggctatgacgaggttcgagacgacacccac
ggcccacagttcaccgactggtacccaggcggcaagataaacatcgcccacaacacgctg
gaccgccacgccgccctcgagaacggcgaccgcaataaggtggcttgcatctgggagggt
gaggacggcgtcgtccgcgaacgcaccttccacgaactccaccggcaggcgaaccgcgtc
gctaactacctcgaatccgtcggcatcgagaccggcgacaccgtcgcgctctacatgccg
atggtgccagaagtcatctcgattctctacggctgcttcaaggtcggcgccatcgctgtc
cccatcttctctggcttcggcgtcgaggcgaccgcgacccgcatcgacgacgccgagcca
tccgtgctgttcaccggcgacggcttctaccgacgcggcagcgccatttctctgaagggc
actgccgacgacgcaatcgaggaggctggccacgtcgagcacaccgttgtctacgaccgg
attgggaccgaggcgcggagcgcctcgaacggagcggggggcgaagcgacccgcggagac
acggagagtgacgaggtcgacgtgccgtggagcgacgaacgcgacgagtggtggggcgag
gtcgtcgagagtcaagagagcgagtacgaaaccaaatcactgcccgccgaccaggagtcg
atgctgctctactcctcgggcacgacgggtgagccgaaaggtatcgttcacacccacgct
ggtgtgctggcccagtgtgccaaagagattcacttcggcttcgaccagaagcccggtgac
cgctttttctgggtcagcgacatcggctggatgatgggcccgtggacgctcatcggcaac
caccacttcggcggcacgacgttcatgtatgagggcgcgcctgactacccaaaccccggc
cgattttgggagatgatcgagcgccatcgcatcacgaccttcggcgtctcaccgacagcc
attcgcgcgctgcgcaagcacggcgacgaggtggtcaagcagtacgacctctccagccta
cgtctcctcggctctaccggcgagccgtgggaccccgaatcctggcagtggtactacgag
gaaattggcaacgaggagtgcccaatcatcaacatctccggcgggaccgaaatttgtggc
tgcttcctgatgccgatgcccatcaacgacctcaagccgggcacgctcggcgggccgggg
ctcgggatggatatcgacatcgttgattcggccgggaactcggtgacggagaaacacgaa
cggggctacctcgtcgcgcgggactcctgtccatcgatgactaagagcctctggtcgggc
gacgagcgctatctcgaggagtactggtccacgtgggaggacctctgggaccacggtgat
ttcgcccagaaggacgaggacggcttctggttcctccacggccgcgcggacgacgcgttg
aacgtggcgggccggaaggtcggccccgccgaaatcgagggtgtgttggccgaacacgat
agcgtgaatcaggccgccgcggtcggcgttgacgacgagacaaccggaacagcagtcgtg
gcctatgtcgtcctcgagagcgggctcgacccgagcgacgaactccgagaggagctccgg
acgctggtcggacaggaacacggcaagccgtttcgccctcgcgagatccgattcgtctcg
gagttccccaaaacccagtcggggaaggtcatccggcgggccatcgccgcggtccaccag
ggcaaggacccgggcgacctctcctcgatggagaacccgagcgcgctcgaggaaatccgg
aacgcccgctaa

DBGET integrated database retrieval system