KEGG   Halophilic archaeon: Halar_2632Help
Entry
Halar_2632        CDS       T01603                                 

Definition
(RefSeq) acetate--CoA ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hah  Halophilic archaeon
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halar_2632
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halar_2632
   00620 Pyruvate metabolism
    Halar_2632
   00640 Propanoate metabolism
    Halar_2632
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Halar_2632
   00680 Methane metabolism
    Halar_2632
Enzymes [BR:hah01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Halar_2632
Lipid biosynthesis proteins [BR:hah01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Halar_2632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1840207..1842258)
Genome map
AA seq 683 aa AA seqDB search
MDASEFEVAHEPSQAFVESTNVWEFMQTYDIDDYDELIERTTSEVPGEPDSGVDWFWDEL
VDYLDIDFYEGYDEVRDDTHGPQFTDWYPGGKINIAHNTLDRHAALENGDRNKVACIWEG
EDGVVRERTFHELHRQANRVANYLESVGIETGDTVALYMPMVPEVISILYGCFKVGAIAV
PIFSGFGVEATATRIDDAEPSVLFTGDGFYRRGSAISLKGTADDAIEEAGHVEHTVVYDR
IGTEARSASNGAGGEATRGDTESDEVDVPWSDERDEWWGEVVESQESEYETKSLPADQES
MLLYSSGTTGEPKGIVHTHAGVLAQCAKEIHFGFDQKPGDRFFWVSDIGWMMGPWTLIGN
HHFGGTTFMYEGAPDYPNPGRFWEMIERHRITTFGVSPTAIRALRKHGDEVVKQYDLSSL
RLLGSTGEPWDPESWQWYYEEIGNEECPIINISGGTEICGCFLMPMPINDLKPGTLGGPG
LGMDIDIVDSAGNSVTEKHERGYLVARDSCPSMTKSLWSGDERYLEEYWSTWEDLWDHGD
FAQKDEDGFWFLHGRADDALNVAGRKVGPAEIEGVLAEHDSVNQAAAVGVDDETTGTAVV
AYVVLESGLDPSDELREELRTLVGQEHGKPFRPREIRFVSEFPKTQSGKVIRRAIAAVHQ
GKDPGDLSSMENPSALEEIRNAR
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgagcgagttcgaggtcgcccacgaacccagtcaggcgttcgtggagtcgacc
aacgtctgggagttcatgcagacgtacgacatcgacgactacgacgaactgatcgaacgc
acaaccagcgaggttccgggggaacccgactcgggcgtcgattggttctgggacgaactc
gtcgactacctcgatatcgacttctacgagggctatgacgaggttcgagacgacacccac
ggcccacagttcaccgactggtacccaggcggcaagataaacatcgcccacaacacgctg
gaccgccacgccgccctcgagaacggcgaccgcaataaggtggcttgcatctgggagggt
gaggacggcgtcgtccgcgaacgcaccttccacgaactccaccggcaggcgaaccgcgtc
gctaactacctcgaatccgtcggcatcgagaccggcgacaccgtcgcgctctacatgccg
atggtgccagaagtcatctcgattctctacggctgcttcaaggtcggcgccatcgctgtc
cccatcttctctggcttcggcgtcgaggcgaccgcgacccgcatcgacgacgccgagcca
tccgtgctgttcaccggcgacggcttctaccgacgcggcagcgccatttctctgaagggc
actgccgacgacgcaatcgaggaggctggccacgtcgagcacaccgttgtctacgaccgg
attgggaccgaggcgcggagcgcctcgaacggagcggggggcgaagcgacccgcggagac
acggagagtgacgaggtcgacgtgccgtggagcgacgaacgcgacgagtggtggggcgag
gtcgtcgagagtcaagagagcgagtacgaaaccaaatcactgcccgccgaccaggagtcg
atgctgctctactcctcgggcacgacgggtgagccgaaaggtatcgttcacacccacgct
ggtgtgctggcccagtgtgccaaagagattcacttcggcttcgaccagaagcccggtgac
cgctttttctgggtcagcgacatcggctggatgatgggcccgtggacgctcatcggcaac
caccacttcggcggcacgacgttcatgtatgagggcgcgcctgactacccaaaccccggc
cgattttgggagatgatcgagcgccatcgcatcacgaccttcggcgtctcaccgacagcc
attcgcgcgctgcgcaagcacggcgacgaggtggtcaagcagtacgacctctccagccta
cgtctcctcggctctaccggcgagccgtgggaccccgaatcctggcagtggtactacgag
gaaattggcaacgaggagtgcccaatcatcaacatctccggcgggaccgaaatttgtggc
tgcttcctgatgccgatgcccatcaacgacctcaagccgggcacgctcggcgggccgggg
ctcgggatggatatcgacatcgttgattcggccgggaactcggtgacggagaaacacgaa
cggggctacctcgtcgcgcgggactcctgtccatcgatgactaagagcctctggtcgggc
gacgagcgctatctcgaggagtactggtccacgtgggaggacctctgggaccacggtgat
ttcgcccagaaggacgaggacggcttctggttcctccacggccgcgcggacgacgcgttg
aacgtggcgggccggaaggtcggccccgccgaaatcgagggtgtgttggccgaacacgat
agcgtgaatcaggccgccgcggtcggcgttgacgacgagacaaccggaacagcagtcgtg
gcctatgtcgtcctcgagagcgggctcgacccgagcgacgaactccgagaggagctccgg
acgctggtcggacaggaacacggcaagccgtttcgccctcgcgagatccgattcgtctcg
gagttccccaaaacccagtcggggaaggtcatccggcgggccatcgccgcggtccaccag
ggcaaggacccgggcgacctctcctcgatggagaacccgagcgcgctcgaggaaatccgg
aacgcccgctaa

DBGET integrated database retrieval system